Property Summary

NCBI Gene PubMed Count 42
Grant Count 5
R01 Count 2
Funding $245,899.67
PubMed Score 65.31
PubTator Score 15.61

Knowledge Summary

Patent

No data available

Expression

 MGI Term (1)

Gene RIF (11)

PMID Text
26172298 eIF3 has a role in controlling cell size independently of S6K1-activity
25336651 Novel RNA-binding protein P311 binds eIF3b to promote translation of TGF-beta1, TGF-beta2, TGF-beta3.
25229650 HIV-1 Gag co-localizes with eIF3b in the cellullar cytoplasmic compartment
24063684 Report EIF3B binding within the IRES domain V of the coxsackie virus B3 mutant strain.
23575475 eIF3b expression relates to human bladder and prostate cancer prognosis, is required for tumor growth, and thus a candidate therapeutic target.
22234522 EIF3B promotes the proliferation of U87 human glioblastoma cells and may play an important role in human glioblastoma development.
22190034 HIV-1 Gag co-localizes with eIF3b in the cellullar cytoplasmic compartment
22190034 HIV-1 Gag co-localizes with eIF3b in the cellullar cytoplasmic compartment
20862284 Yeast eIF3b exhibits RNA binding activity but huamn eIF3b doesn't.
20060839 a conserved tryptophan residue in the human eIF3j N-terminal acidic motif (NTA) is held in the helix alpha1 and loop 5 hydrophobic pocket of the human eIF3b RNA recognition motif (RRM)
More...

AA Sequence

MQDAENVAVPEAAEERAEPGQQQPAAEPPPAEGLLRPAGPGAPEAAGTEASSEEVGIAEAGPESEVRTEP      1 - 70
AAEAEAASGPSESPSPPAAEELPGSHAEPPVPAQGEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEP     71 - 140
RALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKI    141 - 210
FSKFGKITNDFYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWD    211 - 280
IPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLA    281 - 350
TFHQRGIALWGGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHC    351 - 420
ESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIAFWVPEDKDIP    421 - 490
ARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVE    491 - 560
MKETIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRS    561 - 630
MNGALAFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFC    631 - 700
QLLWRPRPPTLLSQEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYME    701 - 770
QKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIPLGNQE                              771 - 814
//

Text Mined References (63)

PMID Year Title
27462815 2016 eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation.
27117702 2016 The m(6)A Methyltransferase METTL3 Promotes Translation in Human Cancer Cells.
26172298 2015 eIF3 controls cell size independently of S6K1-activity.
25849773 2015 eIF3 targets cell-proliferation messenger RNAs for translational activation or repression.
25336651 2014 Novel RNA-binding protein P311 binds eukaryotic translation initiation factor 3 subunit b (eIF3b) to promote translation of transforming growth factor ?1-3 (TGF-?1-3).
24423872 2014 AUF1 contributes to Cryptochrome1 mRNA degradation and rhythmic translation.
24396066 2014 Control of Paip1-eukayrotic translation initiation factor 3 interaction by amino acids through S6 kinase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24063684 2013 Impaired binding of standard initiation factors eIF3b, eIF4G and eIF4B to domain V of the live-attenuated coxsackievirus B3 Sabin3-like IRES--alternatives for 5'UTR-related cardiovirulence mechanisms.
23575475 2013 Translation initiation factor eIF3b expression in human cancer and its role in tumor growth and lung colonization.
More...