Property Summary

NCBI Gene PubMed Count 42
PubMed Score 65.31
PubTator Score 15.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
HIV Infections 100
Disease Target Count P-value
glioblastoma multiforme 347 2.73936131950898E-15
non-small cell lung cancer 2798 2.91211762894085E-15
ovarian cancer 8492 1.6735616646871E-6
osteosarcoma 7933 1.39655869678545E-5
acute quadriplegic myopathy 1157 1.86751203255658E-5
psoriasis 6685 5.74492690773044E-5
colon cancer 1475 7.69091044160312E-5
lung adenocarcinoma 2714 1.09152567504642E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 1.29578195663843E-4
medulloblastoma, large-cell 6234 1.33975821086538E-4
lung cancer 4473 3.06814052142615E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00111481164592987
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00167077458408126
Multiple myeloma 1328 0.00208746655402729
ependymoma 2514 0.00263770261815952
oligodendroglioma 2849 0.00361824222964086
diabetes mellitus 1663 0.00426307616324951
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00431805359636783
group 3 medulloblastoma 2254 0.00880331231408737
astrocytic glioma 2241 0.0125782663414962
gastric carcinoma 832 0.0344164166940751

Expression

Synonym

Accession P55884 A4D208 Q2NL77 Q9UMF9 eIF3b
Symbols PRT1
EIF3S9
EIF3-ETA
EIF3-P110
EIF3-P116

Gene

PDB

2KRB   2NLW   5K1H  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

 MGI Term (1)

Gene RIF (10)

PMID Text
26172298 eIF3 has a role in controlling cell size independently of S6K1-activity
25336651 Novel RNA-binding protein P311 binds eIF3b to promote translation of TGF-beta1, TGF-beta2, TGF-beta3.
25229650 HIV-1 Gag co-localizes with eIF3b in the cellullar cytoplasmic compartment
24063684 Report EIF3B binding within the IRES domain V of the coxsackie virus B3 mutant strain.
23575475 eIF3b expression relates to human bladder and prostate cancer prognosis, is required for tumor growth, and thus a candidate therapeutic target.
22234522 EIF3B promotes the proliferation of U87 human glioblastoma cells and may play an important role in human glioblastoma development.
22190034 HIV-1 Gag co-localizes with eIF3b in the cellullar cytoplasmic compartment
20862284 Yeast eIF3b exhibits RNA binding activity but huamn eIF3b doesn't.
20060839 a conserved tryptophan residue in the human eIF3j N-terminal acidic motif (NTA) is held in the helix alpha1 and loop 5 hydrophobic pocket of the human eIF3b RNA recognition motif (RRM)
17190833 structural analysis of the eIF3b RNA recognition motif and its interaction with eIF3j

AA Sequence

MQDAENVAVPEAAEERAEPGQQQPAAEPPPAEGLLRPAGPGAPEAAGTEASSEEVGIAEAGPESEVRTEP      1 - 70
AAEAEAASGPSESPSPPAAEELPGSHAEPPVPAQGEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEP     71 - 140
RALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKI    141 - 210
FSKFGKITNDFYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWD    211 - 280
IPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLA    281 - 350
TFHQRGIALWGGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHC    351 - 420
ESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIAFWVPEDKDIP    421 - 490
ARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVE    491 - 560
MKETIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRS    561 - 630
MNGALAFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFC    631 - 700
QLLWRPRPPTLLSQEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYME    701 - 770
QKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIPLGNQE                              771 - 814
//

Text Mined References (63)

PMID Year Title
27462815 2016 eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation.
27117702 2016 The m(6)A Methyltransferase METTL3 Promotes Translation in Human Cancer Cells.
26172298 2015 eIF3 controls cell size independently of S6K1-activity.
25849773 2015 eIF3 targets cell-proliferation messenger RNAs for translational activation or repression.
25336651 2014 Novel RNA-binding protein P311 binds eukaryotic translation initiation factor 3 subunit b (eIF3b) to promote translation of transforming growth factor ?1-3 (TGF-?1-3).
24423872 2014 AUF1 contributes to Cryptochrome1 mRNA degradation and rhythmic translation.
24396066 2014 Control of Paip1-eukayrotic translation initiation factor 3 interaction by amino acids through S6 kinase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24063684 2013 Impaired binding of standard initiation factors eIF3b, eIF4G and eIF4B to domain V of the live-attenuated coxsackievirus B3 Sabin3-like IRES--alternatives for 5'UTR-related cardiovirulence mechanisms.
23575475 2013 Translation initiation factor eIF3b expression in human cancer and its role in tumor growth and lung colonization.
More...