Property Summary

NCBI Gene PubMed Count 45
PubMed Score 70.49
PubTator Score 15.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.058 1.9e-05
astrocytic glioma 1.300 1.3e-02
colon cancer 1.200 7.7e-05
diabetes mellitus -1.100 4.3e-03
ependymoma 1.100 2.4e-02
gastric carcinoma 1.200 4.0e-02
glioblastoma 1.100 1.7e-05
group 3 medulloblastoma 1.100 8.9e-04
intraductal papillary-mucinous adenoma (... 1.700 1.3e-04
intraductal papillary-mucinous carcinoma... 1.700 1.1e-03
intraductal papillary-mucinous neoplasm ... 2.200 4.3e-03
lung adenocarcinoma 1.020 1.1e-04
lung cancer 1.300 3.1e-04
medulloblastoma, large-cell 1.500 1.3e-04
Multiple myeloma 1.179 2.1e-03
non-small cell lung cancer 1.133 2.9e-15
oligodendroglioma 1.200 7.2e-03
osteosarcoma -1.756 1.4e-05
ovarian cancer -1.900 2.0e-11
pancreatic ductal adenocarcinoma liver m... 1.638 1.7e-03
psoriasis 1.700 5.7e-05

 MGI Phenotype (1)

Gene RIF (12)

AA Sequence

MQDAENVAVPEAAEERAEPGQQQPAAEPPPAEGLLRPAGPGAPEAAGTEASSEEVGIAEAGPESEVRTEP      1 - 70
AAEAEAASGPSESPSPPAAEELPGSHAEPPVPAQGEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEP     71 - 140
RALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKI    141 - 210
FSKFGKITNDFYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWD    211 - 280
IPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLA    281 - 350
TFHQRGIALWGGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHC    351 - 420
ESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIAFWVPEDKDIP    421 - 490
ARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVE    491 - 560
MKETIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRS    561 - 630
MNGALAFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFC    631 - 700
QLLWRPRPPTLLSQEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYME    701 - 770
QKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIPLGNQE                              771 - 814
//

Text Mined References (66)

PMID Year Title