Property Summary

NCBI Gene PubMed Count 70
Grant Count 17
R01 Count 10
Funding $1,961,284.62
PubMed Score 12.49
PubTator Score 53.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.429 0.007
Multiple myeloma 1.965 0.000
psoriasis 1.400 0.000
non primary Sjogren syndrome sicca 1.100 0.023
ovarian cancer 1.600 0.015

 GO Function (1)

Gene RIF (46)

PMID Text
26458400 Small ubiquitin-related modifier 2/3 interacts with p65 and stabilizes it in the cytoplasm in HBV-associated hepatocellular carcinoma.
26223657 Data indicate that small ubiquitin-like modifiers SUMO1, SUMO2, or SUMO3 were found in nuclear speckles.
26223632 Adenovirus E4-ORF3 targets PIAS3 and together with E1B-55K remodels SUMO2/SUMO3 Interactions in the nucleus and at virus genome replication domains.
25533185 The interactions of SLX4 with SUMO and ubiquitin increase its affinity for factors recognizing different DNA lesions or telomeres, helping to direct the SLX4 complex in distinct functional contexts.
25410875 These findings demonstrated a role for the human adenovirus E4-ORF3 protein as a regulator of ubiquitin-like modifications and revealed new SUMO3 substrates induced by E4-ORF3.
25406032 DBC1 modification by Small Ubiquitin-like Modifier 2/3 is crucial for p53 transactivation under genotoxic stress.
25380826 PHD3 SUMOylation occurs at a cluster of four lysines at the C-terminal end of the protein. Furthermore, PHD3 SUMOylation by SUMO2 or SUMO3 contributes to PHD3-mediated repression of HIF1-dependent transcriptional activity.
25047847 In human cells, Ehrlichia chaffeensis TRP120 was selectively conjugated with SUMO2/3 isoforms.
24942926 Expression of SUMO1/2/3 is dramatically enhanced by interferons through an miRNA-based mechanism involving the Lin28/let-7.
24267727 SUMO-2/3 modification near protein-coding gene promoters occurs in order to maintain host immune-related gene unaltered during viral reactivation.
More...

AA Sequence

MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETD      1 - 70
TPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF                                          71 - 103
//

Text Mined References (76)

PMID Year Title
26458400 2015 Small ubiquitin-related modifier 2/3 interacts with p65 and stabilizes it in the cytoplasm in HBV-associated hepatocellular carcinoma.
26223657 2015 Small Ubiquitin-like Modifier Alters IFN Response.
26223632 2015 Adenovirus E4-ORF3 Targets PIAS3 and Together with E1B-55K Remodels SUMO Interactions in the Nucleus and at Virus Genome Replication Domains.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25556234 2015 New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.
25533185 2015 Noncovalent interactions with SUMO and ubiquitin orchestrate distinct functions of the SLX4 complex in genome maintenance.
25416956 2014 A proteome-scale map of the human interactome network.
25410875 2015 Proteomic analysis of ubiquitin-like posttranslational modifications induced by the adenovirus E4-ORF3 protein.
25406032 2014 Modification of DBC1 by SUMO2/3 is crucial for p53-mediated apoptosis in response to DNA damage.
More...