Property Summary

NCBI Gene PubMed Count 76
PubMed Score 119.44
PubTator Score 53.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.965 1.3e-04
non primary Sjogren syndrome sicca 1.100 2.3e-02
ovarian cancer 1.200 1.5e-05
psoriasis 1.400 2.0e-04
Waldenstrons macroglobulinemia 1.429 6.7e-03

 GO Function (2)

Protein-protein Interaction (6)

Gene RIF (50)

AA Sequence

MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETD      1 - 70
TPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF                                          71 - 103
//

Text Mined References (83)

PMID Year Title