Property Summary

NCBI Gene PubMed Count 309
PubMed Score 1068.88
PubTator Score 597.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Hyperinsulinemic hypoglycemia 17 0.0 5.0

Expression

  Differential Expression (33)

Disease log2 FC p
acute quadriplegic myopathy 1.059 6.3e-04
adrenocortical carcinoma -1.285 3.3e-02
adult high grade glioma 1.900 7.9e-05
astrocytoma 3.000 1.1e-02
Astrocytoma, Pilocytic 1.300 9.0e-04
atypical teratoid / rhabdoid tumor 2.300 1.5e-07
autosomal dominant Emery-Dreifuss muscul... 1.320 2.5e-03
Barrett's esophagus 1.300 2.3e-02
Becker muscular dystrophy 1.152 1.0e-03
cutaneous lupus erythematosus 1.500 2.3e-03
cystic fibrosis -2.217 1.3e-05
Duchenne muscular dystrophy 1.605 7.5e-09
ependymoma 1.400 3.1e-05
esophageal adenocarcinoma 2.100 1.8e-02
gastric carcinoma 1.500 4.2e-02
glioblastoma 1.200 1.8e-03
group 3 medulloblastoma 1.400 1.5e-02
intraductal papillary-mucinous neoplasm ... 1.900 7.7e-03
invasive ductal carcinoma 1.328 1.6e-03
juvenile dermatomyositis 1.191 6.2e-09
limb girdle muscular dystrophy 2A 1.108 2.2e-05
malignant mesothelioma 5.100 1.1e-08
medulloblastoma, large-cell 2.700 4.5e-06
non-inflammatory breast cancer 1.300 6.1e-03
osteosarcoma -1.912 1.3e-02
ovarian cancer 1.500 7.1e-09
primitive neuroectodermal tumor 1.400 4.1e-03
psoriasis -1.200 6.0e-04
Rheumatoid arthritis -2.200 4.0e-03
subependymal giant cell astrocytoma 1.060 4.2e-02
tuberculosis 1.100 2.0e-05
ulcerative colitis 1.200 1.5e-03
Waldenstrons macroglobulinemia 1.134 5.6e-03

Protein-protein Interaction (12)

Gene RIF (344)

AA Sequence

MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGPVRATASAQYRGVMGTILTMV      1 - 70
RTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHASIGSRLLAGSTTGALAVAVAQPTDVV     71 - 140
KVRFQAQARAGGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNCAELVTYDLIKDALLKANLM    141 - 210
TDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSALGQYSSAGHCALTMLQKEGPRAFYKGFMPSFLRL    211 - 280
GSWNVVMFVTYEQLKRALMAACTSREAPF                                             281 - 309
//

Text Mined References (308)

PMID Year Title