Property Summary

NCBI Gene PubMed Count 290
PubMed Score 1022.67
PubTator Score 597.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
malignant mesothelioma 3163 3.01130359131073E-10
juvenile dermatomyositis 1189 6.16767027305636E-9
Duchenne muscular dystrophy 602 7.48245489175785E-9
posterior fossa group B ependymoma 1530 1.54683316997213E-8
atypical teratoid / rhabdoid tumor 4369 1.4747938842673E-7
ovarian cancer 8492 2.66114152474243E-6
tuberculosis 1563 3.63923732807798E-6
pediatric high grade glioma 2712 4.12802584132866E-6
medulloblastoma, large-cell 6234 4.50983036218505E-6
cystic fibrosis 1670 4.65278658555859E-6
limb girdle muscular dystrophy 2A 156 2.21408991537198E-5
glioblastoma 5572 1.07081717107532E-4
pilocytic astrocytoma 3086 1.07781222692633E-4
medulloblastoma 1524 1.57822185155499E-4
osteosarcoma 7933 3.46049664277682E-4
psoriasis 6685 6.04750731301022E-4
acute quadriplegic myopathy 1157 6.26308236714857E-4
cutaneous lupus erythematosus 1056 9.61709273409196E-4
Becker muscular dystrophy 187 0.0010496582269648
ulcerative colitis 2087 0.00143886611211045
invasive ductal carcinoma 2950 0.00305164989306279
Rheumatoid Arthritis 1171 0.00404940823041541
primitive neuroectodermal tumor 3031 0.00413859090910003
subependymal giant cell astrocytoma 2287 0.00460180601653558
X-linked recessive Emery-Dreifuss muscular dystrophy 18 0.0047440088342872
Waldenstrons macroglobulinemia 765 0.0056047322628689
non-inflammatory breast cancer 208 0.00607650369846174
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00773827927255677
astrocytoma 1493 0.0106901590513362
esophageal adenocarcinoma 737 0.0176010007179145
Barrett's esophagus 185 0.0227782803332028
adrenocortical carcinoma 1427 0.0329947315843278
gastric carcinoma 832 0.0418012220314887
Disease Target Count Z-score Confidence
Hyperinsulinemic hypoglycemia 17 0.0 5.0

Expression

Synonym

Accession P55851 Q4PJH8 Q53HM3 UCP 2
Symbols UCPH
BMIQ4
SLC25A8

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA Inparanoid

Gene RIF (325)

PMID Text
26642043 GTPBP3 plays a role in the regulation of UCP2 protein through AMPK signaling.
26526553 Findings in 20 242 individuals suggest that UCP2 gene polymorphisms may cause liver dysfunction through the interaction with body fat rather than alcohol intake.
26450681 Estrogens may increase mitochondrial reactive oxygen species production by repressing uncoupling proteins including UCP2.
26402942 Polymorphism of UCP2 gene is being associated with obesity and diabetes mellitus type 2 among residents of the Moscow Region.
26356408 UCP2 is expressed in human cumulus cells.
26275882 UCP2 as a selective modulator of single channel MCU dependent mitochondrial Ca2+ inward current.
26218518 Data reported here suggest that the UCP2 -866A/55Val/Ins haplotype is associated with an increased risk for DKD and with a lower eGFR in T2DM patients
26181366 ectopic overexpression of UCP2 in a HCC cell line with low endogenous UCP2 expression, HLE, significantly decreased mitochondrial superoxide induction by the anti-cancer drug GEM.
26107945 exogenous expression of miR133a or knockdown of UCP-2 in MCF-7/Dox cells can sensitize their reaction to the treatment of Doxorubicin
26082030 Dissipation of the proton gradient by Ucp2 is not the only determinant of the phagocytic capacity and that anion transfer or nucleotide binding by Ucp2 is also essential for Ucp2-mediated engulfment of apoptotic cells.
More...

AA Sequence

MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGPVRATASAQYRGVMGTILTMV      1 - 70
RTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHASIGSRLLAGSTTGALAVAVAQPTDVV     71 - 140
KVRFQAQARAGGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNCAELVTYDLIKDALLKANLM    141 - 210
TDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSALGQYSSAGHCALTMLQKEGPRAFYKGFMPSFLRL    211 - 280
GSWNVVMFVTYEQLKRALMAACTSREAPF                                             281 - 309
//

Text Mined References (289)

PMID Year Title
26642043 2015 Defective Expression of the Mitochondrial-tRNA Modifying Enzyme GTPBP3 Triggers AMPK-Mediated Adaptive Responses Involving Complex I Assembly Factors, Uncoupling Protein 2, and the Mitochondrial Pyruvate Carrier.
26526553 2015 Interactions between uncoupling protein 2 gene polymorphisms, obesity and alcohol intake on liver function: a large meta-analysed population-based study.
26450681 2015 Regulatory role of estrogen-induced reactive oxygen species in the modulatory function of UCP 2 in papillary thyroid cancer cells.
26402942 2015 [The study of the association of polymorphism rs659366 gene UCP2 c obesity and type 2 diabetes among residents of the Moscow Region].
26356408 2015 Effects of Mitochondrial Uncoupling Protein 2 Inhibition by Genipin in Human Cumulus Cells.
26275882 2015 UCP2 modulates single-channel properties of a MCU-dependent Ca(2+) inward current in mitochondria.
26218518 2015 Polymorphisms of the UCP2 Gene Are Associated with Glomerular Filtration Rate in Type 2 Diabetic Patients and with Decreased UCP2 Gene Expression in Human Kidney.
26181366 2015 Uncoupling protein 2 mediates resistance to gemcitabine-induced apoptosis in hepatocellular carcinoma cell lines.
26107945 2015 MiR-133a Is Functionally Involved in Doxorubicin-Resistance in Breast Cancer Cells MCF-7 via Its Regulation of the Expression of Uncoupling Protein 2.
26082030 2015 Anion Transport or Nucleotide Binding by Ucp2 Is Indispensable for Ucp2-Mediated Efferocytosis.
More...