Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.67
PubTator Score 4.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.300 0.022
oligodendroglioma -1.200 0.048
psoriasis -1.200 0.000
medulloblastoma -1.400 0.000
non diabetic and post-ischemic heart fai... -1.100 0.012
medulloblastoma, large-cell -1.900 0.000
acute quadriplegic myopathy -1.107 0.000
colon cancer -3.100 0.000
lung cancer -1.100 0.006
Breast cancer 2.800 0.029
subependymal giant cell astrocytoma 1.646 0.045

Gene RIF (3)

PMID Text
27100087 RNA-seq evidence of biallelic expression of SH3BGR and 10 neighboring genes in at least one primary human tissue tested indicates that the expression of SH3BGR is uncoupled from the control of the maternally inherited 5mCpG imprints at the WRB differentially methylated region (DMR) in disomic controls or trisomy (Down syndrome) individuals.
20532202 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of SH3 domain binding glutamic acid-rich protein (SH3BGR) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MPLLLLGETEPLKLERDCRSPVDPWAAASPDLALACLCHCQDLSSGAFPDRGVLGGVLFPTVEMVIKVFV      1 - 70
ATSSGSIAIRKKQQEVVGFLEANKIDFKELDIAGDEDNRRWMRENVPGEKKPQNGIPLPPQIFNEEQYCG     71 - 140
DFDSFFSAKEENIIYSFLGLAPPPDSKGSEKAEEGGETEAQKEGSEDVGNLPEAQEKNEEEGETATEETE    141 - 210
EIAMEGAEGEAEEEEETAEGEEPGEDEDS                                             211 - 239
//

Text Mined References (10)

PMID Year Title
27100087 2016 Trisomy 21 Alters DNA Methylation in Parent-of-Origin-Dependent and -Independent Manners.
20532202 2010 Use of genome-wide expression data to mine the "Gray Zone" of GWA studies leads to novel candidate obesity genes.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14767758 2004 Heart morphogenesis is not affected by overexpression of the Sh3bgr gene mapping to the Down syndrome heart critical region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12358155 2002 Screening the proteins that interact with calpain in a human heart cDNA library using a yeast two-hybrid system.
10830953 2000 The DNA sequence of human chromosome 21.
9050928 1997 Cloning a new human gene from chromosome 21q22.3 encoding a glutamic acid-rich protein expressed in heart and skeletal muscle.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.