Property Summary

NCBI Gene PubMed Count 22
Grant Count 23
R01 Count 11
Funding $7,406,161.1
PubMed Score 200.13
PubTator Score 94.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.065 0.003
malignant mesothelioma -3.700 0.000
astrocytic glioma -1.400 0.006
ependymoma -1.600 0.000
glioblastoma -1.900 0.000
oligodendroglioma -1.100 0.000
medulloblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -2.400 0.000
medulloblastoma, large-cell -2.200 0.000
primitive neuroectodermal tumor -2.200 0.004
active Crohn's disease 1.101 0.012
pediatric high grade glioma -1.600 0.000
pilocytic astrocytoma -1.100 0.000
lung carcinoma 1.700 0.000
Pick disease -1.800 0.000
gastric carcinoma -1.500 0.044

Gene RIF (14)

PMID Text
25013050 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that OXCT1 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with OXCT1
25011556 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that OXCT1 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with OXCT1
23420214 Crystal structure of human SCOT, providing a molecular understanding of the reported mutations based on their potential structural effects.
21791085 Data show that the ketone body metabolizing enzymes BDH1, BDH2, OXCT1 and ACAT1 were expressed at the mRNA and protein level in all glioma cell lines.
21296660 Missense Mutations in succinyl-CoA:3-ketoacid CoA transferase is associated with Ketoacidosis.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20652411 Case Report: Succinyl-CoA:3-ketoacid CoA transferase (SCOT) deficiency causes episodic ketoacidotic crises and no apparent symptoms between them.
20381070 This protein has been found differentially expressed in the anterior cingulate cortex from patients with schizophrenia
19296078 The activities of pyruvate carboxylase (SCOT) were decreased by 65% in pancreatic islets of patients with type 2 diabetes.
18648183 liver-specific silencing of the SCOT gene expression may be mediated in part by its 5'-flanking sequence
More...

AA Sequence

MAALKLLSSGLRLCASARGSGATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGATVLVGGFGLCGIP      1 - 70
ENLIDALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGENAEFERQYLSGELEVELTPQGT     71 - 140
LAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREVREFNGQHFILEEAITGDFALV    141 - 210
KAWKADRAGNVIFRKSARNFNLPMCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIE    211 - 280
RLSIRKEGDGEAKSAKPGDDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGL    281 - 350
GPYPRQHEADADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMV    351 - 420
KGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELW    421 - 490
EGLTVDDVQKSTGCDFAVSPKLMPMQQIAN                                            491 - 520
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23420214 2013 A structural mapping of mutations causing succinyl-CoA:3-ketoacid CoA transferase (SCOT) deficiency.
21791085 2011 Differential utilization of ketone bodies by neurons and glioma cell lines: a rationale for ketogenic diet as experimental glioma therapy.
21296660 2011 Clinical and molecular characterization of five patients with succinyl-CoA:3-ketoacid CoA transferase (SCOT) deficiency.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20652411 2010 A neonatal-onset succinyl-CoA:3-ketoacid CoA transferase (SCOT)-deficient patient with T435N and c.658-666dupAACGTGATT p.N220_I222dup mutations in the OXCT1 gene.
20381070 2010 Sex-specific proteome differences in the anterior cingulate cortex of schizophrenia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...