Property Summary

NCBI Gene PubMed Count 22
PubMed Score 227.58
PubTator Score 94.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 1.101 1.2e-02
adult high grade glioma -1.500 7.1e-04
astrocytic glioma -1.400 5.8e-03
Astrocytoma, Pilocytic -1.100 1.3e-05
atypical teratoid / rhabdoid tumor -2.400 2.9e-08
ependymoma -1.400 1.5e-02
gastric carcinoma -1.500 4.4e-02
glioblastoma -1.400 7.0e-07
group 3 medulloblastoma -1.600 4.8e-04
lung carcinoma 1.700 5.2e-24
malignant mesothelioma -3.700 1.5e-08
medulloblastoma, large-cell -2.200 4.1e-05
oligodendroglioma -1.100 9.8e-18
Pick disease -1.800 7.2e-05
primitive neuroectodermal tumor -2.200 4.2e-03
Waldenstrons macroglobulinemia -1.065 2.8e-03

Protein-protein Interaction (2)

Gene RIF (14)

AA Sequence

MAALKLLSSGLRLCASARGSGATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGATVLVGGFGLCGIP      1 - 70
ENLIDALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGENAEFERQYLSGELEVELTPQGT     71 - 140
LAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREVREFNGQHFILEEAITGDFALV    141 - 210
KAWKADRAGNVIFRKSARNFNLPMCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIE    211 - 280
RLSIRKEGDGEAKSAKPGDDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGL    281 - 350
GPYPRQHEADADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMV    351 - 420
KGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELW    421 - 490
EGLTVDDVQKSTGCDFAVSPKLMPMQQIAN                                            491 - 520
//

Text Mined References (27)

PMID Year Title