Property Summary

NCBI Gene PubMed Count 10
PubMed Score 52.98
PubTator Score 4.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 4.19634696662847E-9
Atopic dermatitis 944 3.7342577727527E-4
Breast cancer 3099 0.00308644080047355
nasopharyngeal carcinoma 1056 0.00625340509831171
invasive ductal carcinoma 2950 0.00988504495367409
ductal carcinoma in situ 1745 0.0191358063408886

Expression

  Differential Expression (6)

Disease log2 FC p
posterior fossa group A ependymoma 2.800 0.000
Atopic dermatitis -1.700 0.000
nasopharyngeal carcinoma 1.800 0.006
Breast cancer 1.800 0.003
ductal carcinoma in situ -2.000 0.019
invasive ductal carcinoma -2.800 0.010

Synonym

Accession P55808 E9PCH1 Q496N8 Q496N9 Q496P0 Q71BZ5
Symbols PBDX

Gene

XG

PANTHER Protein Class (1)

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA Inparanoid

Gene RIF (2)

PMID Text
24132906 The pseudoautosomal boundary on Xp22.33/Yp11.31 may harbor male-specific genetic variants for autism spectrum disorders.
18789743 Gene frequency in France is similar to that reported in predominantly white populations.

AA Sequence

MESWWGLPCLAFLCFLMHARGQRDFDLADALDDPEPTKKPNSDIYPKPKPPYYPQPENPDSGGNIYPRPK      1 - 70
PRPQPQPGNSGNSGGYFNDVDRDDGRYPPRPRPRPPAGGGGGGYSSYGNSDNTHGGDHHSTYGNPEGNMV     71 - 140
AKIVSPIVSVVVVTLLGAAASYFKLNNRRNCFRTHEPENV                                  141 - 180
//

Text Mined References (12)

PMID Year Title
24132906 2013 Sex-specific association of a common variant of the XG gene with autism spectrum disorders.
18789743 2008 [Xg gene frequencies in Tunisia].
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10941840 2000 Quantitative analysis of XG blood group and CD99 antigens on human red cells.
10688843 2000 A study of the coregulation and tissue specificity of XG and MIC2 gene expression in eukaryotic cells.
8054981 1994 Cloning of PBDX, an MIC2-related gene that spans the pseudoautosomal boundary on chromosome Xp.
7633446 1995 The human Y chromosome homologue of XG: transcription of a naturally truncated gene.
7533029 1994 PBDX is the XG blood group gene.
More...