Property Summary

NCBI Gene PubMed Count 10
PubMed Score 52.98
PubTator Score 4.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Atopic dermatitis -1.700 3.7e-04
Breast cancer 1.100 1.4e-03
ductal carcinoma in situ -2.000 1.9e-02
ependymoma 2.000 8.0e-05
invasive ductal carcinoma -2.800 9.9e-03
nasopharyngeal carcinoma 1.800 6.3e-03

Gene RIF (2)

AA Sequence

MESWWGLPCLAFLCFLMHARGQRDFDLADALDDPEPTKKPNSDIYPKPKPPYYPQPENPDSGGNIYPRPK      1 - 70
PRPQPQPGNSGNSGGYFNDVDRDDGRYPPRPRPRPPAGGGGGGYSSYGNSDNTHGGDHHSTYGNPEGNMV     71 - 140
AKIVSPIVSVVVVTLLGAAASYFKLNNRRNCFRTHEPENV                                  141 - 180
//

Text Mined References (12)

PMID Year Title