Property Summary

NCBI Gene PubMed Count 10
Grant Count 1
Funding $245,116.67
PubMed Score 52.98
PubTator Score 4.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
posterior fossa group A ependymoma 2.800 0.000
Atopic dermatitis -1.700 0.000
nasopharyngeal carcinoma 1.800 0.006
Breast cancer 1.800 0.003
ductal carcinoma in situ -2.000 0.019
invasive ductal carcinoma -2.800 0.010

Gene RIF (2)

PMID Text
24132906 The pseudoautosomal boundary on Xp22.33/Yp11.31 may harbor male-specific genetic variants for autism spectrum disorders.
18789743 Gene frequency in France is similar to that reported in predominantly white populations.

AA Sequence

MESWWGLPCLAFLCFLMHARGQRDFDLADALDDPEPTKKPNSDIYPKPKPPYYPQPENPDSGGNIYPRPK      1 - 70
PRPQPQPGNSGNSGGYFNDVDRDDGRYPPRPRPRPPAGGGGGGYSSYGNSDNTHGGDHHSTYGNPEGNMV     71 - 140
AKIVSPIVSVVVVTLLGAAASYFKLNNRRNCFRTHEPENV                                  141 - 180
//

Text Mined References (12)

PMID Year Title
24132906 2013 Sex-specific association of a common variant of the XG gene with autism spectrum disorders.
18789743 2008 [Xg gene frequencies in Tunisia].
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10941840 2000 Quantitative analysis of XG blood group and CD99 antigens on human red cells.
10688843 2000 A study of the coregulation and tissue specificity of XG and MIC2 gene expression in eukaryotic cells.
8054981 1994 Cloning of PBDX, an MIC2-related gene that spans the pseudoautosomal boundary on chromosome Xp.
7633446 1995 The human Y chromosome homologue of XG: transcription of a naturally truncated gene.
7533029 1994 PBDX is the XG blood group gene.
More...