Property Summary

NCBI Gene PubMed Count 75
Grant Count 112
R01 Count 72
Funding $8,985,458.84
PubMed Score 274.90
PubTator Score 173.79

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P55789 Q53YM6 Q8TAH6 Q9H290 Q9UK40
Symbols ALR
HPO
HSS
ERV1
HPO1
HPO2
HERV1

Gene

PANTHER Protein Class (2)

PDB

3MBG   3O55   3TK0   3U2L   3U2M   3U5S   4LDK  

 GO Process (1)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
485317 screening 10859 / 1270 / 276674 HTS-Luminescent assay for inhibitors of ALR by detection of hydrogen peroxide production Measured in Biochemical System Using Plate Reader - 2036-02_Inhibitor_SinglePoint_HTS
488787 summary 0 / 0 / 0 Summary of Broad Institute MLPCN Small Molecule Modulators for Redox Regulation in the Mitochondrial Intermembrane Space Project
493248 confirmatory 1447 / 161 / 737 HTS-Luminescent assay for inhibitors of ALR by detection of hydrogen peroxide production Measured in Biochemical System Using Plate Reader - 2036-02_Inhibitor_Dose_CherryPick_Activity

Gene RIF (58)

PMID Text
26271971 Data show that the over-expression of 23 kDa augmenter of liver regeneration (ALR) in hepatic cell line LO2 cells promoted the cell proliferation and enhanced cell resistance to hydrogen peroxide.
26241672 Upregulation of miR-130b enhances stem cell-like phenotype in glioblastoma by inactivating the Hippo signaling pathway.
26104008 FAT1 protein acts upstream of Hippo signalling through TAZ protein to regulate neuronal differentiation.
25954098 ALR protects cells from apoptosis partly through increased autophagy in HepG2 cells.
25929436 Knockdown of GFER exerts anti-inflammatory actions via suppression of the mitogen-activated protein kinase signaling pathway
25778301 Enhanced ALR gene expression was negatively correlated with advanced histopathological grade and stage in both colon cancer cell lines and human tissue samples.
25633409 ALR plays a protective role against hydrogen peroxide-induced oxidative stress in renal proximal tubule cells.
25491506 this review, we briefly describe the components of the Hippo pathway and focus on the recent progress with respect to the regulation of the Hippo pathway by GPCRs and G proteins in cancer cells. [review]
25487919 In this review, we discuss the roles of non-canonical Hippo/Mst signaling pathways in lymphocyte development and functions. [review]
25476206 The purpose of this review is to summarize the recent findings and discuss how Hippo pathway responds to cellular stress and regulates early development events, tissue homeostasis as well as tumorigenesis. [review]
More...

AA Sequence

MAAPGERGRFHGGNLFFLPGGARSEMMDDLATDARGRGAGRRDAAASASTPAQAPTSDSPVAEDASRRRP      1 - 70
CRACVDFKTWMRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFY     71 - 140
PCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD         141 - 205
//

Text Mined References (81)

PMID Year Title
26271971 2015 [Over-expression of augmenter of liver regeneration promotes proliferation and suppresses hydrogen peroxide-induced apoptosis in LO2 cells].
26241672 2015 Upregulation of miR-130b enhances stem cell-like phenotype in glioblastoma by inactivating the Hippo signaling pathway.
26104008 2015 FAT1 cadherin acts upstream of Hippo signalling through TAZ to regulate neuronal differentiation.
25954098 2015 Autophagy in anti-apoptotic effect of augmenter of liver regeneration in HepG2 cells.
25929436 2015 Knockdown of augmenter of liver regeneration in HK-2 cells inhibits inflammation response via the mitogen-activated protein kinase signaling pathway.
25778301 Augmenter of liver regeneration gene expression in human colon cancer cell lines and clinical tissue samples.
25633409 2015 Augmenter of liver regeneration plays a protective role against hydrogen peroxide-induced oxidative stress in renal proximal tubule cells.
25491506 2015 G protein-coupled receptors: bridging the gap from the extracellular signals to the Hippo pathway.
25487919 2015 The non-canonical Hippo/Mst pathway in lymphocyte development and functions.
25476206 2015 Hippo signaling in stress response and homeostasis maintenance.
More...