Property Summary

Ligand Count 457
NCBI Gene PubMed Count 84
PubMed Score 294.21
PubTator Score 173.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Wilson-Turner syndrome 14 3.752 1.9
Liver disease 237 3.056 1.5

Expression

 GO Process (1)

Gene RIF (67)

AA Sequence

MAAPGERGRFHGGNLFFLPGGARSEMMDDLATDARGRGAGRRDAAASASTPAQAPTSDSPVAEDASRRRP      1 - 70
CRACVDFKTWMRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFY     71 - 140
PCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD         141 - 205
//

Text Mined References (90)

PMID Year Title