Property Summary

NCBI Gene PubMed Count 30
Grant Count 55
R01 Count 33
Funding $5,425,442.15
PubMed Score 371.87
PubTator Score 770.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
esophageal adenocarcinoma -1.400 0.018
psoriasis -1.500 0.000
osteosarcoma -1.137 0.001
intraductal papillary-mucinous carcinoma... 1.200 0.004
group 3 medulloblastoma 1.400 0.003
lung adenocarcinoma 1.184 0.000
spina bifida -1.259 0.033
ovarian cancer 2.600 0.000

Gene RIF (9)

PMID Text
26078706 cytosolic peptidases(puromycin-sensitive aminopeptidase (PSA), aminopeptidase B (APB) and pyroglutamyl-peptidase I (PGI) ) may be involved in colorectal carcinogenesis
25342037 MiR-614 inhibited cell invasion and proliferationa targeting PSA in lung cancer cells, PGCL3
25142031 Studies indicate the critical role of M1 aminopeptidases ERAP1, ERAP2 and NPEPPS in immune-mediated diseases.
22944692 Positional proteomics analysis identifies the cleavage of human aminopeptidase puromycin sensitive (NPEPPS) at amino acid residues 677-678 by the HIV-1 protease
21320871 Elevation of NPEPPS activity blocks accumulation of hyperphosphorylated TAU protein and slows down the progression of Alzheimer's disease.
20829225 findings show that by promoting autophagic protein clearance, PSA helps protect against accumulation of aggregation-prone proteins and proteotoxicity
20377816 attenuated proteolysis of FTDP-17 mutant tau may be explained by increased phosphorylation levels, resulting in resistance to proteolysis.
19494703 PSA gene was downregulated in PC-3 cells that were treated with CoCl(2). PSA is involved in the proliferation, migration, and invasion of PC-3 cells, which are important determinants of metastasis, via a mechanism that involves MMP-9 modulation.
14706550 ApPS Y394F exhibited a 3.3-fold lower affinity for RB-3014, a transition state inhibitor, indicating that Tyr394 is involved in transition state stabilization

AA Sequence

MWLAAAAPSLARRLLFLGPPPPPLLLLVFSRSSRRRLHSLGLAAMPEKRPFERLPADVSPINYSLCLKPD      1 - 70
LLDFTFEGKLEAAAQVRQATNQIVMNCADIDIITASYAPEGDEEIHATGFNYQNEDEKVTLSFPSTLQTG     71 - 140
TGTLKIDFVGELNDKMKGFYRSKYTTPSGEVRYAAVTQFEATDARRAFPCWDEPAIKATFDISLVVPKDR    141 - 210
VALSNMNVIDRKPYPDDENLVEVKFARTPVMSTYLVAFVVGEYDFVETRSKDGVCVRVYTPVGKAEQGKF    211 - 280
ALEVAAKTLPFYKDYFNVPYPLPKIDLIAIADFAAGAMENWGLVTYRETALLIDPKNSCSSSRQWVALVV    281 - 350
GHELAHQWFGNLVTMEWWTHLWLNEGFASWIEYLCVDHCFPEYDIWTQFVSADYTRAQELDALDNSHPIE    351 - 420
VSVGHPSEVDEIFDAISYSKGASVIRMLHDYIGDKDFKKGMNMYLTKFQQKNAATEDLWESLENASGKPI    421 - 490
AAVMNTWTKQMGFPLIYVEAEQVEDDRLLRLSQKKFCAGGSYVGEDCPQWMVPITISTSEDPNQAKLKIL    491 - 560
MDKPEMNVVLKNVKPDQWVKLNLGTVGFYRTQYSSAMLESLLPGIRDLSLPPVDRLGLQNDLFSLARAGI    561 - 630
ISTVEVLKVMEAFVNEPNYTVWSDLSCNLGILSTLLSHTDFYEEIQEFVKDVFSPIGERLGWDPKPGEGH    631 - 700
LDALLRGLVLGKLGKAGHKATLEEARRRFKDHVEGKQILSADLRSPVYLTVLKHGDGTTLDIMLKLHKQA    701 - 770
DMQEEKNRIERVLGATLLPDLIQKVLTFALSEEVRPQDTVSVIGGVAGGSKHGRKAAWKFIKDNWEELYN    771 - 840
RYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCENILLNAAWLKRDAESIHQYLL    841 - 910
QRKASPPTV                                                                 911 - 919
//

Text Mined References (38)

PMID Year Title
26078706 2015 Altered Activity and Expression of Cytosolic Peptidases in Colorectal Cancer.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
25342037 2014 [MiR-614 inhibited lung cancer cell invasion and proliferation via targeting PSA].
25142031 2014 Genetic associations and functional characterization of M1 aminopeptidases and immune-mediated diseases.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
24234648 2014 No evidence for shared genetic basis of common variants in multiple sclerosis and amyotrophic lateral sclerosis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21320871 2011 Puromycin-sensitive aminopeptidase (PSA/NPEPPS) impedes development of neuropathology in hPSA/TAU(P301L) double-transgenic mice.
21269460 2011 Initial characterization of the human central proteome.
More...