Property Summary

NCBI Gene PubMed Count 107
PubMed Score 183.29
PubTator Score 206.83

Knowledge Summary

Patent

No data available

Synonym

Accession P55774 B5BUM2 Q53X71
Symbols CKb7
PARC
AMAC1
DCCK1
MIP-4
AMAC-1
DC-CK1
SCYA18

Gene

PDB

4MHE  

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

Gene RIF (96)

AA Sequence

MKGLAAALLVLVCTMALCSCAQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQIC      1 - 70
ADPNKKWVQKYISDLKLNA                                                        71 - 89
//

Text Mined References (108)

PMID Year Title