Property Summary

NCBI Gene PubMed Count 90
Grant Count 207
R01 Count 63
Funding $35,006,569.5
PubMed Score 170.98
PubTator Score 206.83

Knowledge Summary

Patent

No data available

Synonym

Accession P55774 B5BUM2 Q53X71
Symbols CKb7
PARC
AMAC1
DCCK1
MIP-4
AMAC-1
DC-CK1
SCYA18

Gene

PDB

4MHE  

Gene RIF (79)

PMID Text
26416449 our findings suggest that CCL18 released from tumor-associated macrophages promotes angiogenesis and tumor progression in breast cancer.
26294068 CCL18 is significantly up-regulated in breast cancer vs benign tumors or normal breast. It increased with the size of tumors, the number of lymph node metastasis, and advancing tumor stage.
26244871 Findings suggest that down-regulation of miR98 and miR27b promotes CCL18-mediated invasion and migration of breast cancer cells.
26113374 A common CCL18 polymorphism together with intraventricular hemorrhage had an additive influence on cerebral palsy susceptibility.
25794928 The CCL18 levels in serum and synovial fluid are correlated with the severity of osteoarthritis.
25502147 Combined functions of CCL18 in mesenchymal and cancer cells might accelerate the progression of PDAC by promoting the epithelial-mesenchymal transition, invasion and migration of pancreatic cancer cells.
25412496 CCL17 and CCL18 dermal expression is associated with leprosy polarity.
25275026 CCL18 expression was positively correlated with malignancy in EC.
25197632 upregulation of CCL18 may be involved in the malignant progression of prostate cancer.
25142483 Increased CCL18 levels characterize chronic Pseudomonas aeruginosa infection and pulmonary obstruction in patients with cystic fibrosis.
More...

AA Sequence

MKGLAAALLVLVCTMALCSCAQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQIC      1 - 70
ADPNKKWVQKYISDLKLNA                                                        71 - 89
//

Text Mined References (91)

PMID Year Title
26416449 2015 CCL18 from tumor-associated macrophages promotes angiogenesis in breast cancer.
26294068 2015 Chemokine C-C motif ligand 18 expression correlates with tumor malignancy in breast cancer.
26244871 2015 CCL18-mediated down-regulation of miR98 and miR27b promotes breast cancer metastasis.
26113374 2015 Cerebral Palsy and Polymorphism of the Chemokine CCL18 in Very Preterm Children.
25794928 2015 Serum and synovial fluid levels of CCL18 are correlated with radiographic grading of knee osteoarthritis.
25502147 2015 CCL18 promotes epithelial-mesenchymal transition, invasion and migration of pancreatic cancer cells in pancreatic ductal adenocarcinoma.
25412496 2014 Differential dermal expression of CCL17 and CCL18 in tuberculoid and lepromatous leprosy.
25275026 2014 Expression of chemokine ligand 18 in stage IA low-grade endometrial cancer.
25197632 2014 CC chemokine ligand 18 correlates with malignant progression of prostate cancer.
25142483 2014 The chemokine CCL18 characterises Pseudomonas infections in cystic fibrosis lung disease.
More...