Property Summary

NCBI Gene PubMed Count 42
PubMed Score 51.74
PubTator Score 44.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Mesothelioma, Malignant 105 0.0 0.0
Disease Target Count
malignant mesothelioma 3232
Disease Target Count P-value
non-small cell lung cancer 2890 4.8e-15
lung adenocarcinoma 2716 2.4e-11
osteosarcoma 7950 3.4e-10
interstitial cystitis 2312 4.7e-02

Gene RIF (24)

AA Sequence

MKVSVAALSCLMLVTALGSQARVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTPRSIPCSLLES      1 - 70
YFETNSECSKPGVIFLTKKGRRFCANPSDKQVQVCVRMLKLDTRIKTRKN                         71 - 120
//

Text Mined References (43)

PMID Year Title