Property Summary

NCBI Gene PubMed Count 42
Grant Count 2
Funding $102,472.25
PubMed Score 48.75
PubTator Score 44.11

Knowledge Summary

Patent

No data available

Synonym

Accession P55773 B7ZKQ3 O00174 O75950 Q52LD4
Symbols CKb8
MIP3
Ckb-8
MIP-3
MPIF-1
SCYA23
Ckb-8-1
hmrp-2a
CK-BETA-8

Gene

 Grant Application (2)

PDB

1G91  

Gene RIF (24)

PMID Text
26560043 CCL23 is posttranslationally modified by trypsin-like serine proteases and CCL23(47-117) might be a major active form of CCL23 in nasal polyps with chronic rhinosinusitis.
24995525 The coexistence of diabetes and oxidative stress independently affected CCL23 levels, while the presence of Cardiovascular disease and inflammation had no impact on its concentrations.
24384427 ADAMTS 8, CCL23, and TNFSF15 are implicated in anti-angiogenic activities
21656154 Data show CCL23 stimulates chemotaxis of human THP-1 monocytes and enhances release of MMP-2, and suggest it plays a role in atherogenesis.
21646793 Fresh eosinophils contained trace amounts of CCL23 protein. CCL23 was significantly released into the supernatant when the eosinophils were stimulated with GM-CSF or IL-5 but not with IFN-gamma or immobilized sIgA.
21497884 Overproduction of CCL23 in nasal polyps might contribute to the pathogenesis of eosinophilic chronic rhinosinusitis with nasal polyps
21109018 The role of KLF6 and PPAR-gamma in MIP-3alpha transcriptional regulation, was determined.
20824279 Patients with systemic sclerosis who had elevated CCL23 levels had shorter disease duration, and a higher frequency of pulmonary arterial hypertension. Serum CCL23 level was increased in early phase of disease and could be a marker for disease activity.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MKVSVAALSCLMLVTALGSQARVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTPRSIPCSLLES      1 - 70
YFETNSECSKPGVIFLTKKGRRFCANPSDKQVQVCVRMLKLDTRIKTRKN                         71 - 120
//

Text Mined References (43)

PMID Year Title
26560043 2016 Tissue proteases convert CCL23 into potent monocyte chemoattractants in patients with chronic rhinosinusitis.
24995525 2014 Effect of diabetes and oxidative stress on plasma CCL23 levels in patients with severe chronic kidney disease.
24384427 2014 Genome-wide study reveals an important role of spontaneous autoimmunity, cardiomyocyte differentiation defect and anti-angiogenic activities in gender-specific gene expression in Keshan disease.
23932459 2014 Genome-wide association study of lung function phenotypes in a founder population.
22633458 2012 The chemokine superfamily revisited.
22147696 2012 Biochemical analysis of matrix metalloproteinase activation of chemokines CCL15 and CCL23 and increased glycosaminoglycan binding of CCL16.
21666788 2011 Effects of chronic ascariasis and trichuriasis on cytokine production and gene expression in human blood: a cross-sectional study.
21656154 2011 Potential involvement of CCL23 in atherosclerotic lesion formation/progression by the enhancement of chemotaxis, adhesion molecule expression, and MMP-2 release from monocytes.
21646793 2011 Human eosinophils produce and release a novel chemokine, CCL23, in vitro.
21497884 2011 Increased expression of the chemokine CCL23 in eosinophilic chronic rhinosinusitis with nasal polyps.
More...