Property Summary

NCBI Gene PubMed Count 82
PubMed Score 130.46
PubTator Score 130.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
esophageal adenocarcinoma -2.400 2.0e-02
lung adenocarcinoma 1.100 6.0e-04
non-small cell lung cancer 1.189 2.7e-09
spina bifida -3.153 4.3e-02

 GWAS Trait (1)

Gene RIF (72)

AA Sequence

MEPAFGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGA      1 - 70
IGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNKIGNLAQQGHY     71 - 140
DSYKQHQPTPQPALPYNHIYSYPSPITAAAAKVPTPPGVPAIPGSVAMPRTWPSSHSVTDILGIRSITDQ    141 - 210
VSDSSPYHSPKVEEWSSLGRNNFPAAAPHAVNGLEKGALEQEAKYGQAPNGLPAVGSFVSASSMAPYPTP    211 - 280
AQVSPYMTYSAAPSGYVAGHGWQHAGGTSLSPHNCDIPASLAFKGMQAAREGSHSVTASAL             281 - 341
//

Text Mined References (82)

PMID Year Title