Property Summary

NCBI Gene PubMed Count 29
PubMed Score 55.18
PubTator Score 21.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.5e-07
glioblastoma 5792 5.4e-07
psoriasis 6694 2.5e-04
ovarian cancer 8520 1.4e-03
lung cancer 4740 1.2e-02
non primary Sjogren syndrome sicca 891 4.1e-02
Disease Target Count Z-score Confidence
Silver-Russell syndrome 39 3.307 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma -1.100 5.4e-07
lung cancer 1.100 1.2e-02
non primary Sjogren syndrome sicca 1.100 4.1e-02
osteosarcoma -1.991 1.5e-07
ovarian cancer -1.100 1.4e-03
psoriasis -1.200 2.5e-04

Gene RIF (8)

AA Sequence

MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLP      1 - 70
LLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV                 71 - 128
//

Text Mined References (35)

PMID Year Title