Property Summary

NCBI Gene PubMed Count 28
PubMed Score 53.68
PubTator Score 21.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.46058528947396E-7
glioblastoma 5572 5.43761694034322E-7
ovarian cancer 8492 1.87510952324724E-4
psoriasis 6685 2.5006220415408E-4
lung cancer 4473 0.0118295131111018
non primary Sjogren syndrome sicca 840 0.0405196361091436
Disease Target Count Z-score Confidence
Silver-Russell syndrome 37 3.371 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.200 0.000
osteosarcoma -1.991 0.000
glioblastoma -1.100 0.000
lung cancer 1.100 0.012
non primary Sjogren syndrome sicca 1.100 0.041
ovarian cancer 1.600 0.000

Synonym

Accession P55769
Symbols FA1
FA-1
NHPX
15.5K
OTK27
SSFA1
NHP2L1
SPAG12
SNRNP15-5

Gene

PDB

2OZB   3JCR   3SIU   3SIV   1E7K   2JNB  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (7)

PMID Text
23166591 Expression of HIV-1 Tat upregulates the abundance of NHP2 non-histone chromosome protein 2-like 1 (NHP2L1) in the nucleoli of Jurkat T-cells
22190034 Expression of HIV-1 Tat upregulates the abundance of NHP2 non-histone chromosome protein 2-like 1 (NHP2L1) in the nucleoli of Jurkat T-cells
19620283 snoRNP assembly factor NUFIP can regulate the interactions between TIP48 and TIP49 and the core box C/D proteins.
18044964 describe the solution NMR structure of free 15.5K, as well as studies of conformational flexibility from 15N NMR relaxation and H/D exchange experiments
12417735 Data show that binding of the 15.5 kD RNA binding protein to the box C/D motif of snoRNAs is essential for the association of other snoRNP-associated proteins.
12203836 the testis-specific expression of FA-1 antigen at the mRNA level
12011111 NHPX is specifically accumulated in both nucleoli and Cajal bodies (CBs) in vivo. The data show a specific temporal pathway involving the sequential and directed accumulation of NHPX in distinct subnuclear compartments

AA Sequence

MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLP      1 - 70
LLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV                 71 - 128
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22190034 2011 Global landscape of HIV-human protein complexes.
21269460 2011 Initial characterization of the human central proteome.
19620283 2009 Evidence that the AAA+ proteins TIP48 and TIP49 bridge interactions between 15.5K and the related NOP56 and NOP58 proteins during box C/D snoRNP biogenesis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18044964 2007 Functional implications for a prototypical K-turn binding protein from structural and dynamical studies of 15.5K.
More...