Property Summary

NCBI Gene PubMed Count 33
Grant Count 37
R01 Count 30
Funding $3,625,089.09
PubMed Score 90.51
PubTator Score 48.66

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
glioblastoma 1.300 0.003
ovarian cancer 2.000 0.000

Gene RIF (7)

PMID Text
25452588 GNL2 and SEC13 are required for nonsense-mediated mRNA decay pathway in human cells.
24825317 HIV-1 gp120/MBL complex co-localizes with intracellular COPII vesicle markers Sec31A and Sec13 in neuronal cells
22331354 When embedded in a three-dimensional matrix, Sec13-depleted Caco-2 cells form cysts but, unlike controls, are defective in lumen expansion.
19682973 The identified Sec13 interaction to PS1 is a new candidate interaction for linking PS1 to secretory and protein degrading vesicular circuits.
18713835 Data show that coupling of the Sec23/24 and Sec13/31 layers of the COPII coat is required to drive export of collagen from the endoplasmic reticulum, and that efficient COPII assembly is essential for normal craniofacial development during embryogenesis.
18160040 Determine crystal structure of Sec13-Nup145C dimer.
16407955 three-dimensional reconstruction of Sec13/31 cages at 30 A resolution using cryo-electron microscopy and single particle analysis

AA Sequence

MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMY      1 - 70
GNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQW     71 - 140
EVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEA    141 - 210
HSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVS    211 - 280
GGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ                                281 - 322
//

Text Mined References (46)

PMID Year Title
27487210 2016 Mechanism of arginine sensing by CASTOR1 upstream of mTORC1.
27194810 2016 Systematic Protein-Protein Interaction Analysis Reveals Intersubcomplex Contacts in the Nuclear Pore Complex.
26972053 2016 The CASTOR Proteins Are Arginine Sensors for the mTORC1 Pathway.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25457612 2014 Sestrins inhibit mTORC1 kinase activation through the GATOR complex.
25452588 2015 Identification and characterization of novel factors that act in the nonsense-mediated mRNA decay pathway in nematodes, flies and mammals.
25416956 2014 A proteome-scale map of the human interactome network.
25263562 2014 The Sestrins interact with GATOR2 to negatively regulate the amino-acid-sensing pathway upstream of mTORC1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23723238 2013 A Tumor suppressor complex with GAP activity for the Rag GTPases that signal amino acid sufficiency to mTORC1.
More...