Property Summary

NCBI Gene PubMed Count 36
PubMed Score 88.67
PubTator Score 48.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 4.8e-05
glioblastoma 5792 2.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (2)

Disease log2 FC p
glioblastoma 1.300 2.7e-03
ovarian cancer 2.000 4.8e-05

Gene RIF (7)

AA Sequence

MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMY      1 - 70
GNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQW     71 - 140
EVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEA    141 - 210
HSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVS    211 - 280
GGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ                                281 - 322
//

Text Mined References (49)

PMID Year Title