Property Summary

NCBI Gene PubMed Count 36
Grant Count 10
R01 Count 10
Funding $549,914.51
PubMed Score 52.74
PubTator Score 28.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -2.000 0.000
osteosarcoma -1.663 0.000
group 4 medulloblastoma 1.800 0.000

Gene RIF (11)

PMID Text
25157139 PREP1 modulates the cellular sensitivity to TGF-beta by inducing the small mothers against decapentaplegic homolog 3 (SMAD3) nuclear translocation.
22347417 Single nucleotide polymorphism in gene encoding transcription factor Prep1 is associated with HIV-1-associated dementia
22185299 High levels of MEIS1 and PREP1, and low levels of PBX4 expression were founded in samples of patients with ALL.
21715654 The tumor suppressor role of Prep1 is associated with the maintenance of genomic stability.
21203543 analysis of the regulatory region of the zebrafish Prep1.1 gene and the promoter of human PREP1
20106730 Immunohistochemistry on tissue micrroarrays (TMA) generated from three distinct human cohorts comprising a total of some 1000 human tumors revealed that 70% of the tumors express no or extremely low levels of Prep1, unlike normal tissues.
19260141 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18093541 Interleukin-10 expression in macrophages during phagocytosis of apoptotic cells is mediated by homeodomain proteins Pbx1 and Prep-1.
12871956 PREP-1 has a role in F9 teratocarcinoma cells: it causes an increase of PBX-2 by preventing its degradation
12771203 PKNOX1 gene-dosage imbalance is associated with overexpression of FABP7 in Down syndrome fetal brains.
More...

AA Sequence

MMATQTLSIDSYQDGQQMQVVTELKTEQDPNCSEPDAEGVSPPPVESQTPMDVDKQAIYRHPLFPLLALL      1 - 70
FEKCEQSTQGSEGTTSASFDVDIENFVRKQEKEGKPFFCEDPETDNLMVKAIQVLRIHLLELEKVNELCK     71 - 140
DFCSRYIACLKTKMNSETLLSGEPGSPYSPVQSQQIQSAITGTISPQGIVVPASALQQGNVAMATVAGGT    141 - 210
VYQPVTVVTPQGQVVTQTLSPGTIRIQNSQLQLQLNQDLSILHQDDGSSKNKRGVLPKHATNVMRSWLFQ    211 - 280
HIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQPMLDSSCSETPKTKKKTAQNRPVQRFWPDSI    281 - 350
ASGVAQPPPSELTMSEGAVVTITTPVNMNVDSLQSLSSDGATLAVQQVMMAGQSEDESVDSTEEDAGALA    351 - 420
PAHISGLVLENSDSLQ                                                          421 - 436
//

Text Mined References (38)

PMID Year Title
25343990 2015 Genome-wide association study of selenium concentrations.
25157139 2014 Transcription factor PREP1 induces EMT and metastasis by controlling the TGF-?-SMAD3 pathway in non-small cell lung adenocarcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22347417 2012 Single nucleotide polymorphism in gene encoding transcription factor Prep1 is associated with HIV-1-associated dementia.
22185299 2011 MEIS1, PREP1, and PBX4 are differentially expressed in acute lymphoblastic leukemia: association of MEIS1 expression with higher proliferation and chemotherapy resistance.
21715654 2011 Homeodomain transcription factor and tumor suppressor Prep1 is required to maintain genomic stability.
21203543 2010 Characterization of the regulatory region of the zebrafish Prep1.1 gene: analogies to the promoter of the human PREP1.
21130836 2011 Whole genome association scan for genetic polymorphisms influencing information processing speed.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
20106730 2010 Prep1 (pKnox1)-deficiency leads to spontaneous tumor development in mice and accelerates EmuMyc lymphomagenesis: a tumor suppressor role for Prep1.
More...