Property Summary

NCBI Gene PubMed Count 37
PubMed Score 57.51
PubTator Score 28.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 6.2e-06
psoriasis 6694 2.7e-04
group 3 medulloblastoma 4104 1.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Down syndrome 499 3.021 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.500 1.2e-03
osteosarcoma -1.663 6.2e-06
psoriasis -2.000 2.7e-04

Protein-protein Interaction (6)

Gene RIF (11)

AA Sequence

MMATQTLSIDSYQDGQQMQVVTELKTEQDPNCSEPDAEGVSPPPVESQTPMDVDKQAIYRHPLFPLLALL      1 - 70
FEKCEQSTQGSEGTTSASFDVDIENFVRKQEKEGKPFFCEDPETDNLMVKAIQVLRIHLLELEKVNELCK     71 - 140
DFCSRYIACLKTKMNSETLLSGEPGSPYSPVQSQQIQSAITGTISPQGIVVPASALQQGNVAMATVAGGT    141 - 210
VYQPVTVVTPQGQVVTQTLSPGTIRIQNSQLQLQLNQDLSILHQDDGSSKNKRGVLPKHATNVMRSWLFQ    211 - 280
HIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQPMLDSSCSETPKTKKKTAQNRPVQRFWPDSI    281 - 350
ASGVAQPPPSELTMSEGAVVTITTPVNMNVDSLQSLSSDGATLAVQQVMMAGQSEDESVDSTEEDAGALA    351 - 420
PAHISGLVLENSDSLQ                                                          421 - 436
//

Text Mined References (39)

PMID Year Title