Property Summary

NCBI Gene PubMed Count 29
Grant Count 12
R01 Count 3
Funding $736,375.12
PubMed Score 18.57
PubTator Score 13.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.300 0.030
psoriasis 1.900 0.001
osteosarcoma -2.378 0.000
ependymoma 1.100 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
glioblastoma -1.500 0.000
medulloblastoma -1.300 0.001
medulloblastoma, large-cell -2.100 0.000
non-small cell lung cancer -1.022 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.007
pediatric high grade glioma -1.100 0.000
Breast cancer -1.100 0.000
ovarian cancer 1.500 0.000

Gene RIF (10)

PMID Text
24911119 This study demonstrates the role and significant correlation between a histone methyltransferase (PRMT2)-dependent signature, RORgamma, the cell-cycle regulation, DNA repair circuits, and breast cancer survival outcomes.
24292672 This study uncovers the molecular mechanism of PRMT2 regulating the expression of CCND1 in invasive ductal breast carcinoma.
22093364 characterization of 3 PRMT2 splice variants (PRMT2alpha, PRMT2beta, and PRMT2gamma) from breast cancer; these variants bind to ERalpha in vitro/in vivo; overall PRMT2 expression is upregulated in breast cancer and associated w/ ERalpha positivity
21851090 the SH3 domain may mediate an interaction between PRMT1 and -2 in a methylation-dependent fashion
21820040 Data suggest that post-transcriptional processing mechanism as alternative polyadenylation and splicing may play a crucial role in regulating human PRMT2 gene expression.
19405910 Here we report methylation activity from PRMT2 and compare it with PRMT1 activity using UPLC-MS/MS (ultra-performance liquid chromatography-tandem MS), gel electrophoresis, and thin-layer chromatography
19161160 Observational study of gene-disease association. (HuGE Navigator)
17587566 ligand-dependent AR conformation is essential for the recruitment and nuclear translocation of PMRT2 which acts as AR-coactivator, presumably by arginine methylation.
16648481 PRMT2 inhibits NF-kappa B function and promotes apoptosis.
12039952 PRMT2 is a novel ERalpha coactivator.

AA Sequence

MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWG      1 - 70
ERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKV     71 - 140
ILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVS    141 - 210
EWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLA    211 - 280
VKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSL    281 - 350
QEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPT    351 - 420
SQKVGEKVFPIWR                                                             421 - 433
//

Text Mined References (31)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
24911119 2014 PRMT2 and ROR? expression are associated with breast cancer survival outcomes.
24292672 2014 Nuclear loss of protein arginine N-methyltransferase 2 in breast carcinoma is associated with tumor grade and overexpression of cyclin D1 protein.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
22093364 2012 Identification and characterization of novel spliced variants of PRMT2 in breast carcinoma.
21851090 2011 A protein arginine N-methyltransferase 1 (PRMT1) and 2 heteromeric interaction increases PRMT1 enzymatic activity.
21820040 2011 Identification and expression analysis of a novel transcript of the human PRMT2 gene resulted from alternative polyadenylation in breast cancer.
19405910 2009 Kinetic analysis of human protein arginine N-methyltransferase 2: formation of monomethyl- and asymmetric dimethyl-arginine residues on histone H4.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
More...