Property Summary

NCBI Gene PubMed Count 31
PubMed Score 18.81
PubTator Score 13.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.300 3.0e-02
atypical teratoid / rhabdoid tumor -1.600 9.2e-05
Breast cancer -1.100 1.8e-10
ependymoma 1.100 4.4e-08
glioblastoma -1.500 1.6e-04
group 4 medulloblastoma -1.200 1.6e-03
intraductal papillary-mucinous adenoma (... 1.100 6.8e-03
medulloblastoma, large-cell -2.100 1.9e-04
non-small cell lung cancer -1.022 8.0e-17
osteosarcoma 1.127 8.0e-04
ovarian cancer -1.200 9.4e-05
pediatric high grade glioma -1.100 3.6e-04
psoriasis 1.900 7.8e-04

Gene RIF (11)

AA Sequence

MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWG      1 - 70
ERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKV     71 - 140
ILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVS    141 - 210
EWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLA    211 - 280
VKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSL    281 - 350
QEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPT    351 - 420
SQKVGEKVFPIWR                                                             421 - 433
//

Text Mined References (33)

PMID Year Title