Property Summary

NCBI Gene PubMed Count 53
Grant Count 17
R01 Count 14
Funding $1,583,512.18
PubMed Score 76.93
PubTator Score 58.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Gene RIF (33)

PMID Text
26183179 findings uncover a new isoform-specific role for TPD52 in promoting intracellular lipid storage, which might be relevant to TPD52 overexpression in cancer.
25511701 these data firstly demonstrated that miR-218 directly regulates oncogenic TPD52 in PC3 cells and the miR-218-TPD52 axis can regulate growth of this prostate cancer cell line.
24947143 low TPD52 expression was identified as a strong independent prognostic factor for both recurrence-free and overall disease-related survival in patients with insulinomas
24798974 highlight the potential value of genes such as TPD52, which are overexpressed in many cancer types, but have been relatively understudied [review]
24768995 Data indicate that TPD52 and miR-224 expression are negatively correlated in clinical specimens.
24604726 PLP2 and RAB5C are binding partners of TPD52.
24317684 TPD52 overexpression is associated with neoplasms.
23974097 TPD52 is a novel negative regulator of ATM protein levels, in turn, impacts ATM-mediated cellular responses to DNA damage.
23661506 TPD52 is a survival factor in ERBB2-amplified breast cancer.
23104178 Increased PrLZ-mediated androgen receptor transactivation promotes prostate cancer growth at castration-resistant stage.
More...

AA Sequence

MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKFGLLRTDPVPEEGEDVAATISATET      1 - 70
LSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTS     71 - 140
ETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASA    141 - 210
TTTEPLPEKTQESL                                                            211 - 224
//

Text Mined References (58)

PMID Year Title
26183179 2015 TPD52 expression increases neutral lipid storage within cultured cells.
25511701 2015 microRNA-218 inhibits prostate cancer cell growth and promotes apoptosis by repressing TPD52 expression.
24947143 2015 Novel prognostic markers revealed by a proteomic approach separating benign from malignant insulinomas.
24798974 2014 Tumor protein D52 (TPD52) and cancer-oncogene understudy or understudied oncogene?
24768995 2014 Tumour-suppressive microRNA-224 inhibits cancer cell migration and invasion via targeting oncogenic TPD52 in prostate cancer.
24604726 2014 Identification of PLP2 and RAB5C as novel TPD52 binding partners through yeast two-hybrid screening.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24317684 2014 Patterns of TPD52 overexpression in multiple human solid tumor types analyzed by quantitative PCR.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23974097 2013 Tumor protein D52 represents a negative regulator of ATM protein levels.
More...