Property Summary

NCBI Gene PubMed Count 53
PubMed Score 76.93
PubTator Score 58.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Prostatic Neoplasms 471
Disease Target Count P-value
lung carcinoma 2844 2.76546354055584E-30
non-small cell lung cancer 2798 1.96522328542381E-19
breast carcinoma 1614 6.63490559510913E-17
malignant mesothelioma 3163 3.53057549878865E-10
lung adenocarcinoma 2714 4.00074916489001E-9
tuberculosis 1563 8.41000122549879E-7
primitive neuroectodermal tumor 3031 3.82310424300364E-6
osteosarcoma 7933 3.36872746483274E-5
ovarian cancer 8492 3.78127974778236E-5
group 4 medulloblastoma 1875 6.04304481675149E-5
atypical teratoid / rhabdoid tumor 4369 9.54907090032464E-5
pediatric high grade glioma 2712 9.8221756522089E-5
Multiple myeloma 1328 1.01765519008855E-4
psoriasis 6685 2.66177617812224E-4
cystic fibrosis 1670 2.71569994756895E-4
glioblastoma 5572 3.09986268097372E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 6.57842605189193E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00120003189154138
ductal carcinoma in situ 1745 0.00149300171848222
invasive ductal carcinoma 2950 0.00179158391323667
cutaneous lupus erythematosus 1056 0.00222789204395062
lung cancer 4473 0.00337539516400028
astrocytic glioma 2241 0.00545866083572063
Pick disease 1893 0.00549785999017422
chronic lymphosyte leukemia 232 0.00562027521670686
oligodendroglioma 2849 0.0110031801792487
ependymoma 2514 0.0217668300814172
subependymal giant cell astrocytoma 2287 0.0221777878334496
Breast cancer 3099 0.0292029200457483
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0336380273198101
fibroadenoma 557 0.040864218892313
Disease Target Count Z-score Confidence
Cancer 2346 3.569 1.8

Expression

  Differential Expression (31)

Synonym

Gene

  Ortholog (9)

Gene RIF (33)

PMID Text
26183179 findings uncover a new isoform-specific role for TPD52 in promoting intracellular lipid storage, which might be relevant to TPD52 overexpression in cancer.
25511701 these data firstly demonstrated that miR-218 directly regulates oncogenic TPD52 in PC3 cells and the miR-218-TPD52 axis can regulate growth of this prostate cancer cell line.
24947143 low TPD52 expression was identified as a strong independent prognostic factor for both recurrence-free and overall disease-related survival in patients with insulinomas
24798974 highlight the potential value of genes such as TPD52, which are overexpressed in many cancer types, but have been relatively understudied [review]
24768995 Data indicate that TPD52 and miR-224 expression are negatively correlated in clinical specimens.
24604726 PLP2 and RAB5C are binding partners of TPD52.
24317684 TPD52 overexpression is associated with neoplasms.
23974097 TPD52 is a novel negative regulator of ATM protein levels, in turn, impacts ATM-mediated cellular responses to DNA damage.
23661506 TPD52 is a survival factor in ERBB2-amplified breast cancer.
23104178 Increased PrLZ-mediated androgen receptor transactivation promotes prostate cancer growth at castration-resistant stage.
More...

AA Sequence

MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKFGLLRTDPVPEEGEDVAATISATET      1 - 70
LSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTS     71 - 140
ETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASA    141 - 210
TTTEPLPEKTQESL                                                            211 - 224
//

Text Mined References (58)

PMID Year Title
26183179 2015 TPD52 expression increases neutral lipid storage within cultured cells.
25511701 2015 microRNA-218 inhibits prostate cancer cell growth and promotes apoptosis by repressing TPD52 expression.
24947143 2015 Novel prognostic markers revealed by a proteomic approach separating benign from malignant insulinomas.
24798974 2014 Tumor protein D52 (TPD52) and cancer-oncogene understudy or understudied oncogene?
24768995 2014 Tumour-suppressive microRNA-224 inhibits cancer cell migration and invasion via targeting oncogenic TPD52 in prostate cancer.
24604726 2014 Identification of PLP2 and RAB5C as novel TPD52 binding partners through yeast two-hybrid screening.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24317684 2014 Patterns of TPD52 overexpression in multiple human solid tumor types analyzed by quantitative PCR.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23974097 2013 Tumor protein D52 represents a negative regulator of ATM protein levels.
More...