Property Summary

NCBI Gene PubMed Count 64
PubMed Score 83.01
PubTator Score 58.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
astrocytic glioma -1.800 6.7e-03
atypical teratoid / rhabdoid tumor -1.300 6.5e-03
Breast cancer 2.800 2.9e-02
breast carcinoma 1.400 1.4e-03
chronic lymphosyte leukemia -1.100 5.6e-03
cutaneous lupus erythematosus -1.500 2.2e-03
cystic fibrosis 1.115 5.5e-04
ductal carcinoma in situ 2.800 1.5e-03
ependymoma -1.700 4.2e-02
fibroadenoma 1.400 4.1e-02
glioblastoma -1.100 1.2e-03
group 4 medulloblastoma -1.500 8.9e-03
intraductal papillary-mucinous adenoma (... 1.400 1.8e-02
intraductal papillary-mucinous carcinoma... 1.600 3.0e-02
intraductal papillary-mucinous neoplasm ... 1.800 3.4e-02
invasive ductal carcinoma 4.700 1.8e-03
lung adenocarcinoma 2.344 1.8e-09
lung cancer 1.200 1.3e-02
lung carcinoma 2.100 2.8e-30
malignant mesothelioma 2.800 1.8e-06
Multiple myeloma 1.934 1.0e-04
non-small cell lung cancer 1.773 2.0e-19
oligodendroglioma -1.700 3.1e-02
osteosarcoma -1.852 3.4e-05
ovarian cancer 1.600 8.9e-04
pediatric high grade glioma -1.300 3.8e-04
Pick disease -1.600 5.5e-03
primitive neuroectodermal tumor -1.500 3.3e-03
psoriasis 1.100 3.0e-03
subependymal giant cell astrocytoma -3.058 2.2e-02
tuberculosis 1.400 8.4e-07

Gene RIF (44)

AA Sequence

MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKFGLLRTDPVPEEGEDVAATISATET      1 - 70
LSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTS     71 - 140
ETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASA    141 - 210
TTTEPLPEKTQESL                                                            211 - 224
//

Text Mined References (69)

PMID Year Title