Property Summary

NCBI Gene PubMed Count 22
Grant Count 28
R01 Count 21
Funding $2,186,643.63
PubMed Score 24.16
PubTator Score 15.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Prostatic Neoplasms 471
uncontrolled asthma 67

Expression

  Differential Expression (1)

Disease log2 FC p
uncontrolled asthma 1.100 0.001

Gene RIF (7)

PMID Text
25672906 Our study identified novel FOXA3 variants and mutations, assessed the adipogenic capacity of two novel missense alterations in vitro and demonstrated for the first time the associations between FOXA3 SNP rs28666870 with metabolic phenotypes in humans.
24392884 Foxa3 induces goblet cell metaplasia and inhibits innate antiviral immunity in asthma and chronic obstructive pulmonary disease.
23798556 In obese subjects, FOXA3 is differentially expressed in visceral and subcutaneous adipose depots.
22659429 low caloric intake decreases the production of intracellular reactive oxygen species and suppresses endothelial cells senescence through promoting HNF3gamma binging to NOX4 promoter region and inhibiting NOX4 gene expression induced by up-regulated HNF3gamma
19934400 Observational study of gene-disease association. (HuGE Navigator)
19919681 analysis of the binding pattern of FOXA1 and FOXA3 and their relation to H3K4me3 in HepG2 cells
15737987 the HNF-3 site in the fibrinogen beta promoter is important for IL6-induced expression, and its activity is influenced by the adjacent -148C/T polymorphism

AA Sequence

MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGPLAPPAP      1 - 70
AAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTL     71 - 140
SEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQ    141 - 210
KRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASST    211 - 280
PYFTGLELPGELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS    281 - 350
//

Text Mined References (23)

PMID Year Title
25672906 2015 Analysis of variants and mutations in the human winged helix FOXA3 gene and associations with metabolic traits.
24392884 2014 Foxa3 induces goblet cell metaplasia and inhibits innate antiviral immunity.
23798556 2013 The winged helix transcription factor Foxa3 regulates adipocyte differentiation and depot-selective fat tissue expansion.
22659429 2012 [Caloric restriction suppresses endothelial cells senescence via down-regulation of NOX4 induced by HNF3?].
19934400 2010 Genetic predictors of interindividual variability in hepatic CYP3A4 expression.
19919681 2009 Differential binding and co-binding pattern of FOXA1 and FOXA3 and their relation to H3K4me3 in HepG2 cells revealed by ChIP-seq.
19706729 2009 Regulation of the CYP3A4 and CYP3A7 promoters by members of the nuclear factor I transcription factor family.
18239190 2008 Foxp2 inhibits Nkx2.1-mediated transcription of SP-C via interactions with the Nkx2.1 homeodomain.
15839736 2005 Differentiation of insulin-producing cells from human neural progenitor cells.
15737987 2005 A hepatocyte nuclear factor-3 site in the fibrinogen beta promoter is important for interleukin 6-induced expression, and its activity is influenced by the adjacent -148C/T polymorphism.
More...