Property Summary

NCBI Gene PubMed Count 22
PubMed Score 29.27
PubTator Score 15.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count P-value
uncontrolled asthma 56 5.9e-04

Expression

  Differential Expression (1)

Disease log2 FC p
uncontrolled asthma 1.100 5.9e-04

Gene RIF (7)

AA Sequence

MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGPLAPPAP      1 - 70
AAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTL     71 - 140
SEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQ    141 - 210
KRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASST    211 - 280
PYFTGLELPGELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS    281 - 350
//

Text Mined References (23)

PMID Year Title