Property Summary

NCBI Gene PubMed Count 168
PubMed Score 249.06
PubTator Score 209.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Fatty Liver 70 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
DOID:9917 31 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 4.783 2.4

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer -2.200 1.7e-03
breast carcinoma 2.400 2.0e-04
ductal carcinoma in situ 3.700 9.7e-03
fibroadenoma 2.300 2.7e-03
interstitial cystitis -2.800 1.6e-02
invasive ductal carcinoma 4.400 8.4e-04
lung adenocarcinoma 1.100 3.0e-03
lung carcinoma 1.800 2.1e-19
psoriasis -1.600 7.3e-22

Gene RIF (146)

AA Sequence

MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMTPASFNMSYAN      1 - 70
PGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQAASMNGLGPYAAAMNPCMSP     71 - 140
MAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQN    141 - 210
QQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGS    211 - 280
GSGGSGAKGGPESRKDPSGASNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELK    281 - 350
TPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAY    351 - 420
EQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS                      421 - 472
//

Text Mined References (175)

PMID Year Title