Property Summary

NCBI Gene PubMed Count 139
Grant Count 134
R01 Count 71
Funding $13,658,081.39
PubMed Score 215.72
PubTator Score 209.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
breast carcinoma 2.700 0.001
fibroadenoma 2.700 0.014
interstitial cystitis -4.200 0.000
lung adenocarcinoma 1.100 0.003
lung carcinoma 1.800 0.000
ductal carcinoma in situ 3.700 0.010
invasive ductal carcinoma 4.400 0.001
Breast cancer -2.700 0.003
psoriasis -1.600 0.000

Synonym

Accession P55317 B2R9H6 B7ZAP5 Q9H2A0 HNF-3-alpha
Symbols HNF3A
TCF3A

Gene

Gene RIF (119)

PMID Text
27045898 FoxA1, FoxA2, and LIPG control the uptake of extracellular lipids for breast cancer growth.
26986977 prostate staining level does not appear to have a major impact on risk of recurrence after salvage radiation therapy
26929406 Loss of Interdependent Binding by the FoxO1 and FoxA1/A2 Forkhead Transcription Factors Culminates in Perturbation of Active Chromatin Marks and Binding of Transcriptional Regulators at Insulin-sensitive Genes.
26708273 The expression of FOXA1 appears to be involved in the proliferation of immature breast cancer cells rather than the induction of stemness-related genes and self-renewal potency of cancer stem cells.
26658322 The ratio of FoxA1 to FoxA2 in lung adenocarcinoma is regulated by LncRNA HOTAIR and chromatin remodeling factor LSH
26541755 findings suggest a key role for GalNAc-T4 in the estrogen pathway through FOXA1 glycosylation
26527523 Immunohistochemical detectionof GATA-3 and FOXA1 expression is useful to differentiate breast carcinoma from other carcinomas.
26457646 Data show that transcription factor FOXA1 and homeodomain protein HOXB13 colocalize with androgen receptor (AR) at tumor-specific AR binding sites.
26336819 Data suggests that androgen receptor variants (AR-Vs) are dependent on forkhead box A1 protein (FOXA1) for sustaining a pro-proliferative gene signature.
26260807 TNBC with coexpression of AR and FOXA1 seems to behave like luminal tumors with a morphological profile distinct from other TNBC.
More...

AA Sequence

MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMTPASFNMSYAN      1 - 70
PGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQAASMNGLGPYAAAMNPCMSP     71 - 140
MAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQN    141 - 210
QQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGS    211 - 280
GSGGSGAKGGPESRKDPSGASNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELK    281 - 350
TPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAY    351 - 420
EQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS                      421 - 472
//

Text Mined References (146)

PMID Year Title
27045898 2016 FoxA and LIPG endothelial lipase control the uptake of extracellular lipids for breast cancer growth.
26986977 2016 An Examination of the Association between FOXA1 Staining Level and Biochemical Recurrence following Salvage Radiation Therapy for Recurrent Prostate Cancer.
26929406 2016 Loss of Interdependent Binding by the FoxO1 and FoxA1/A2 Forkhead Transcription Factors Culminates in Perturbation of Active Chromatin Marks and Binding of Transcriptional Regulators at Insulin-sensitive Genes.
26708273 2016 FOXA1 expression affects the proliferation activity of luminal breast cancer stem cell populations.
26658322 2015 The ratio of FoxA1 to FoxA2 in lung adenocarcinoma is regulated by LncRNA HOTAIR and chromatin remodeling factor LSH.
26541755 2016 GalNAc-T4 putatively modulates the estrogen regulatory network through FOXA1 glycosylation in human breast cancer cells.
26527523 2016 GATA-3 and FOXA1 expression is useful to differentiate breast carcinoma from other carcinomas.
26457646 2015 The androgen receptor cistrome is extensively reprogrammed in human prostate tumorigenesis.
26336819 2015 FOXA1 regulates androgen receptor variant activity in models of castrate-resistant prostate cancer.
26260807 2015 Coexpression of androgen receptor and FOXA1 in nonmetastatic triple-negative breast cancer: ancillary study from PACS08 trial.
More...