Property Summary

NCBI Gene PubMed Count 63
PubMed Score 438.91
PubTator Score 541.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Rett syndrome 18
Epilepsy 792
Abnormality of the antihelix 10
Abnormality of the antitragus 5
Abnormality of the fingernails 51
Abnormality of the metacarpal bones 17
Absent speech 43
Acquired flat foot 72
Acquired scoliosis 281
Agenesis of corpus callosum 83
Apraxias 27
Athetosis 16
Bilateral fifth finger clinodactyly 110
Blepharophimosis 70
Bruxism 18
Bulbous nasal tip 48
Bulbous nose 48
Cerebellar hypoplasia and atrophy 41
Cerebral atrophy 178
Chorea 29
Choreatic disease 52
Class III malocclusion 78
Concave bridge of nose 195
Congenital Epicanthus 177
Congenital clubfoot 109
Congenital deafness 185
Constipation 181
Cortical gyral simplification 19
Curvature of little finger 110
Curvature of spine 282
Deafness 198
Delayed myelination 22
Depressed nasal bridge 195
Depressed nasal root/bridge 195
Developmental regression 95
Dilated ventricles (finding) 121
Downward slant of palpebral fissure 158
Drooling 27
Dull intelligence 645
Dyschezia 135
Dyskinetic syndrome 16
Dystonia 164
Dystonic disease 106
Edema of eyelid 10
Electroencephalogram abnormal 101
Everted lower lip vermilion 54
FOXG1 syndrome 1
Feeding difficulties 127
Fine hair 42
Flatfoot 73
Flexion contracture of proximal interphalangeal joint 75
Gastroesophageal reflux disease 110
Growth delay 114
Growth failure 114
Growth retardation 115
Hearing Loss, Partial 185
Heartburn 78
Hyperkyphosis 111
Hypertrophy of lower jaw 78
Hypoplasia of corpus callosum 90
Increased size of mandible 78
Inverted V-shaped upper lip 19
Isolated cases 72
Kyphosis deformity of spine 114
Long philtrum 137
Loss of developmental milestones 95
Low intelligence 645
Macroglossia 65
Macrostomia 72
Mandibular hyperplasia 78
Mental Retardation 645
Mental deficiency 645
Mental deterioration in childhood 95
Motor delay 147
Movement Disorders 55
Muscle Spasticity 195
Muscle hypotonia 571
Neonatal Hypotonia 64
Nephrolithiasis 56
Neurodevelopmental regression 95
No development of motor milestones 147
Pachygyria 41
Poor eye contact 12
Poor growth 114
Poor school performance 645
Potato nose 48
Progressive microcephaly 32
Prominent ear 56
Prominent metopic ridge 15
Protruding ears 56
Protruding lower lip 54
Psychomotor regression 95
Psychomotor regression beginning in infancy 95
Psychomotor regression in infants 95
Psychomotor regression, progressive 95
Rett Syndrome, Atypical 4
Severe mental retardation (I.Q. 20-34) 99
Short nose 132
Sialorrhea 28
Small head 374
Small nose 132
Smooth philtrum 43
Stereotyped Behavior 37
Stereotypic Movement Disorder 42
Tented mouth 19
Tented upper lip 19
Thick vermilion border 25
Thin hypoplastic alae nasi 51
Tongue thrusting 2
Very poor growth 114
Wide nose 35
hearing impairment 199
mandibular excess (physical finding) 78
nervous system disorder 53
nonverbal 43
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0

Expression

  Differential Expression (8)

Disease log2 FC p
Astrocytoma, Pilocytic -3.700 1.2e-03
atypical teratoid / rhabdoid tumor -3.000 2.9e-02
cystic fibrosis 7.169 4.5e-10
ependymoma -2.700 9.1e-03
lung cancer 3.600 7.6e-06
malignant mesothelioma 7.600 3.9e-10
medulloblastoma -3.000 4.0e-02
psoriasis -1.500 4.6e-03

Synonym

Accession P55316 A6NFY2 P55315 Q14488 Q86XT7
Symbols BF1
BF2
QIN
FKH2
HBF2
HFK1
HFK2
HFK3
KHL2
FHKL3
FKHL1
FKHL2
FKHL3
FKHL4
HBF-1
HBF-2
HBF-3
FOXG1A
FOXG1B
FOXG1C
HBF-G2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (1)

Gene RIF (43)

AA Sequence

MLDMGDRKEVKMIPKSSFSINSLVPEAVQNDNHHASHGHHNSHHPQHHHHHHHHHHHPPPPAPQPPPPPQ      1 - 70
QQQPPPPPPPAPQPPQTRGAPAADDDKGPQQLLLPPPPPPPPAAALDGAKADGLGGKGEPGGGPGELAPV     71 - 140
GPDEKEKGAGAGGEEKKGAGEGGKDGEGGKEGEKKNGKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEF    141 - 210
IMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTS    211 - 280
RAKLAFKRGARLTSTGLTFMDRAGSLYWPMSPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQNSL    281 - 350
GNNHSFSTANGLSVDRLVNGEIPYATHHLTAAALAASVPCGLSVPCSGTYSLNPCSVNLLAGQTSYFFPH    351 - 420
VPHPSMTSQSSTSMSARAASSSTSPQAPSTLPCESLRPSLPSFTTGLSGGLSDYFTHQNQGSSSNPLIH     421 - 489
//

Text Mined References (65)

PMID Year Title