Property Summary

NCBI Gene PubMed Count 54
Grant Count 90
R01 Count 58
Funding $11,329,363.84
PubMed Score 412.56
PubTator Score 541.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 7.600 0.000
posterior fossa group A ependymoma -4.200 0.000
cystic fibrosis 7.169 0.000
atypical teratoid / rhabdoid tumor -3.000 0.029
sonic hedgehog group medulloblastoma -3.600 0.026
lung cancer 5.000 0.000
pilocytic astrocytoma -3.700 0.001
psoriasis -1.500 0.005

Synonym

Accession P55316 A6NFY2 P55315 Q14488 Q86XT7
Symbols BF1
BF2
QIN
FKH2
HBF2
HFK1
HFK2
HFK3
KHL2
FHKL3
FKHL1
FKHL2
FKHL3
FKHL4
HBF-1
HBF-2
HBF-3
FOXG1A
FOXG1B
FOXG1C
HBF-G2

Gene

Gene RIF (34)

PMID Text
26523971 These findings suggest a central AKT-FOXG1-reelin signaling pathway in focal malformations of cortical development and support pathway inhibitors as potential treatments or therapies for some forms of focal epilepsy.
26455392 EGFR mutations remodel the activated enhancer landscape of glioblastoma multiforme, promoting tumorigenesis through a SOX9 and FOXG1-dependent transcriptional regulatory network in vitro and in vivo.
26433703 We propose that the disruption of signaling pathways that promote mature neuronal differentiation by overexpressed FOXG1 is a contributing event in the neoplastic transformation of cerebellar stem cells.
26364767 FOXG1 mutations are associated with familial recurrence in FOXG1-related disorders.
26186191 Data suggest that a shift toward GABAergic neuron fate caused by FOXG1 is a developmental precursor of autism spectrum disorder.
25966633 these results implicate the overexpression of a group of neuropeptides in the basal ganglia, hypothalamus, cortex and hippocampus in the pathogenesis FOXG1 behavioral impairments.
25565401 The neurological phenotype of FOXG1 haploinsufficiency shows the features of a dyskinetic encephalopathy of infancy.
25251503 critical role in the regulation of hepatocellular carcinoma development
24836831 Genotype-phenotype studies of FOXG1 may help to elucidate why children develop different forms of developmental epilepsy.
24738188 Its mutation causes Rett syndrome.(review)
More...

AA Sequence

MLDMGDRKEVKMIPKSSFSINSLVPEAVQNDNHHASHGHHNSHHPQHHHHHHHHHHHPPPPAPQPPPPPQ      1 - 70
QQQPPPPPPPAPQPPQTRGAPAADDDKGPQQLLLPPPPPPPPAAALDGAKADGLGGKGEPGGGPGELAPV     71 - 140
GPDEKEKGAGAGGEEKKGAGEGGKDGEGGKEGEKKNGKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEF    141 - 210
IMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTS    211 - 280
RAKLAFKRGARLTSTGLTFMDRAGSLYWPMSPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQNSL    281 - 350
GNNHSFSTANGLSVDRLVNGEIPYATHHLTAAALAASVPCGLSVPCSGTYSLNPCSVNLLAGQTSYFFPH    351 - 420
VPHPSMTSQSSTSMSARAASSSTSPQAPSTLPCESLRPSLPSFTTGLSGGLSDYFTHQNQGSSSNPLIH     421 - 489
//

Text Mined References (55)

PMID Year Title
26523971 2015 An AKT3-FOXG1-reelin network underlies defective migration in human focal malformations of cortical development.
26455392 2015 EGFR Mutation Promotes Glioblastoma through Epigenome and Transcription Factor Network Remodeling.
26433703 2015 FOXG1 expression shows correlation with neuronal differentiation in cerebellar development, aggressive phenotype in medulloblastomas, and survival in a xenograft model of medulloblastoma.
26364767 2015 Familial recurrences of FOXG1-related disorder: Evidence for mosaicism.
26186191 2015 FOXG1-Dependent Dysregulation of GABA/Glutamate Neuron Differentiation in Autism Spectrum Disorders.
25966633 2016 Altered expression of neuropeptides in FoxG1-null heterozygous mutant mice.
25565401 2015 Forkhead box G1 gene haploinsufficiency: an emerging cause of dyskinetic encephalopathy of infancy.
25251503 2015 Double-negative feedback loop between microRNA-422a and forkhead box (FOX)G1/Q1/E1 regulates hepatocellular carcinoma tumor growth and metastasis.
24836831 2014 Epilepsy and outcome in FOXG1-related disorders.
24825563 2014 Common genetic variants associated with resting oxygenation in chronic obstructive pulmonary disease.
More...