Property Summary

NCBI Gene PubMed Count 21
PubMed Score 34.31
PubTator Score 40.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.600 2.7e-03
atypical teratoid / rhabdoid tumor -1.400 3.0e-04
diabetes mellitus -1.200 1.1e-02
glioblastoma -1.500 1.1e-03
lung adenocarcinoma 1.300 2.6e-04
osteosarcoma 1.379 1.7e-02

Gene RIF (4)

AA Sequence

MDAAFLLVLGLLAQSLCLSLGVPGWRRPTTLYPWRRAPALSRVRRAWVIPPISVSENHKRLPYPLVQIKS      1 - 70
DKQQLGSVIYSIQGPGVDEEPRGVFSIDKFTGKVFLNAMLDREKTDRFRLRAFALDLGGSTLEDPTDLEI     71 - 140
VVVDQNDNRPAFLQEAFTGRVLEGAVPGTYVTRAEATDADDPETDNAALRFSILQQGSPELFSIDELTGE    141 - 210
IRTVQVGLDREVVAVYNLTLQVADMSGDGLTATASAIITLDDINDNAPEFTRDEFFMEAIEAVSGVDVGR    211 - 280
LEVEDRDLPGSPNWVARFTILEGDPDGQFTIRTDPKTNEGVLSIVKALDYESCEHYELKVSVQNEAPLQA    281 - 350
AALRAERGQAKVRVHVQDTNEPPVFQENPLRTSLAEGAPPGTLVATFSARDPDTEQLQRLSYSKDYDPED    351 - 420
WLQVDAATGRIQTQHVLSPASPFLKGGWYRAIVLAQDDASQPRTATGTLSIEILEVNDHAPVLAPPPPGS    421 - 490
LCSEPHQGPGLLLGATDEDLPPHGAPFHFQLSPRLPELGRNWSLSQVNVSHARLRPRHQVPEGLHRLSLL    491 - 560
LRDSGQPPQQREQPLNVTVCRCGKDGVCLPGAAALLAGGTGLSLGALVIVLASALLLLVLVLLVALRARF    561 - 630
WKQSRGKGLLHGPQDDLRDNVLNYDEQGGGEEDQDAYDISQLRHPTALSLPLGPPPLRRDAPQGRLHPQP    631 - 700
PRVLPTSPLDIADFINDGLEAADSDPSVPPYDTALIYDYEGDGSVAGTLSSILSSQGDEDQDYDYLRDWG    701 - 770
PRFARLADMYGHPCGLEYGARWDHQAREGLSPGALLPRHRGRTA                              771 - 814
//

Text Mined References (21)

PMID Year Title