Property Summary

NCBI Gene PubMed Count 21
Grant Count 26
R01 Count 8
Funding $8,304,510.46
PubMed Score 33.23
PubTator Score 40.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.379 0.017
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.500 0.001
diabetes mellitus -1.200 0.011
adult high grade glioma -1.600 0.003
lung adenocarcinoma 1.300 0.000

Gene RIF (4)

PMID Text
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19012874 Alterations in CDH15 in patients with mild to severe intellectual disability are reported.
12052883 The cell adhesion molecule M-cadherin is not essential for muscle development and regeneration.

AA Sequence

MDAAFLLVLGLLAQSLCLSLGVPGWRRPTTLYPWRRAPALSRVRRAWVIPPISVSENHKRLPYPLVQIKS      1 - 70
DKQQLGSVIYSIQGPGVDEEPRGVFSIDKFTGKVFLNAMLDREKTDRFRLRAFALDLGGSTLEDPTDLEI     71 - 140
VVVDQNDNRPAFLQEAFTGRVLEGAVPGTYVTRAEATDADDPETDNAALRFSILQQGSPELFSIDELTGE    141 - 210
IRTVQVGLDREVVAVYNLTLQVADMSGDGLTATASAIITLDDINDNAPEFTRDEFFMEAIEAVSGVDVGR    211 - 280
LEVEDRDLPGSPNWVARFTILEGDPDGQFTIRTDPKTNEGVLSIVKALDYESCEHYELKVSVQNEAPLQA    281 - 350
AALRAERGQAKVRVHVQDTNEPPVFQENPLRTSLAEGAPPGTLVATFSARDPDTEQLQRLSYSKDYDPED    351 - 420
WLQVDAATGRIQTQHVLSPASPFLKGGWYRAIVLAQDDASQPRTATGTLSIEILEVNDHAPVLAPPPPGS    421 - 490
LCSEPHQGPGLLLGATDEDLPPHGAPFHFQLSPRLPELGRNWSLSQVNVSHARLRPRHQVPEGLHRLSLL    491 - 560
LRDSGQPPQQREQPLNVTVCRCGKDGVCLPGAAALLAGGTGLSLGALVIVLASALLLLVLVLLVALRARF    561 - 630
WKQSRGKGLLHGPQDDLRDNVLNYDEQGGGEEDQDAYDISQLRHPTALSLPLGPPPLRRDAPQGRLHPQP    631 - 700
PRVLPTSPLDIADFINDGLEAADSDPSVPPYDTALIYDYEGDGSVAGTLSSILSSQGDEDQDYDYLRDWG    701 - 770
PRFARLADMYGHPCGLEYGARWDHQAREGLSPGALLPRHRGRTA                              771 - 814
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19012874 2008 Alterations in CDH15 and KIRREL3 in patients with mild to severe intellectual disability.
15923648 2005 Close encounters: regulation of vertebrate skeletal myogenesis by cell-cell contact.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12634428 2003 Promyogenic members of the Ig and cadherin families associate to positively regulate differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12052883 2002 The cell adhesion molecule M-cadherin is not essential for muscle development and regeneration.
More...