Property Summary

NCBI Gene PubMed Count 171
Grant Count 61
R01 Count 18
Funding $7,811,653.08
PubMed Score 189.29
PubTator Score 208.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
non-small cell lung carcinoma -1.400 0.000
breast carcinoma -1.500 0.000
fibroadenoma -1.400 0.045
lung adenocarcinoma -1.800 0.000

Synonym

Accession P55290 A8W476 A8W477 B7Z590 C9JRI6 J3KN62 Q6GTW4 Q8TBX3
Symbols CDHH
P105

Gene

PANTHER Protein Class (2)

PDB

2V37  

Gene RIF (123)

PMID Text
26600672 CDH13 locus variants and adiponectin levels are associated with circulating levels of cellular adhesion molecules and adiposity status in a differential manner that interacts with sex
26597461 Data demonstrate for the first time that SHP1 methylation has high specificity for diagnosis of endometrial carcinoma, while CDH13 promoter methylation plays a role in the earlier stage.
26362652 The present study identified a new genetic factor for CRC risk and an interaction between CDH13 and APN in CRC risk. These genetic factors may be useful for predicting CRC risk.
25875811 The genetic polymorphisms at the CDH13 locus independently affect the adiponectin levels, whereas the adiponectin levels exhibit a suppressive effect on the association between CDH13 locus variants and various metabolic phenotypes and metabolic syndrome
25847144 The downregulation of T-cadherin may contribute to gastric cancer progression, representing a useful biomarker for predicting the biological behavior and prognosis of gastric cancer.
25739828 The CDH13 rs11150556 CC genotype was associated with more hyperactive/impulsive symptoms in attention/deficit hyperactivity disorder.
25735345 CDH13 promoter methylation is associated with lung cancer.
25677746 Our results suggested that negative T-cadherin expression has a worse prognosis in patients with axillary lymph node-positive breast cancer.
25543204 Several SNPs in the CDH13 promoter region are significantly associated with the level of DNA methylation at nearby CpG sites.
25450229 This study finding significant excess of rare nonsynonymous variants exclusive to European Americans smokers in CHD13.
More...

AA Sequence

MQPRTPLVLCVLLSQVLLLTSAEDLDCTPGFQQKVFHINQPAEFIEDQSILNLTFSDCKGNDKLRYEVSS      1 - 70
PYFKVNSDGGLVALRNITAVGKTLFVHARTPHAEDMAELVIVGGKDIQGSLQDIFKFARTSPVPRQKRSI     71 - 140
VVSPILIPENQRQPFPRDVGKVVDSDRPERSKFRLTGKGVDQEPKGIFRINENTGSVSVTRTLDREVIAV    141 - 210
YQLFVETTDVNGKTLEGPVPLEVIVIDQNDNRPIFREGPYIGHVMEGSPTGTTVMRMTAFDADDPATDNA    211 - 280
LLRYNIRQQTPDKPSPNMFYIDPEKGDIVTVVSPALLDRETLENPKYELIIEAQDMAGLDVGLTGTATAT    281 - 350
IMIDDKNDHSPKFTKKEFQATVEEGAVGVIVNLTVEDKDDPTTGAWRAAYTIINGNPGQSFEIHTNPQTN    351 - 420
EGMLSVVKPLDYEISAFHTLLIKVENEDPLVPDVSYGPSSTATVHITVLDVNEGPVFYPDPMMVTRQEDL    421 - 490
SVGSVLLTVNATDPDSLQHQTIRYSVYKDPAGWLNINPINGTVDTTAVLDRESPFVDNSVYTALFLAIDS    491 - 560
GNPPATGTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLSVVILGASDKDLHPNTDPFKFEIHKQAVPDK    561 - 630
VWKISKINNTHALVSLLQNLNKANYNLPIMVTDSGKPPMTNITDLRVQVCSCRNSKVDCNAAGALRFSLP    631 - 700
SVLLLSLFSLACL                                                             701 - 713
//

Text Mined References (175)

PMID Year Title
26600672 2015 Differential Associations between CDH13 Genotypes, Adiponectin Levels, and Circulating Levels of Cellular Adhesive Molecules.
26597461 2016 Methylation of tumor suppressor gene CDH13 and SHP1 promoters and their epigenetic regulation by the UHRF1/PRMT5 complex in endometrial carcinoma.
26362652 2015 Gene-gene interaction analysis identifies a new genetic risk factor for colorectal cancer.
25875811 2015 Association of CDH13 genotypes/haplotypes with circulating adiponectin levels, metabolic syndrome, and related metabolic phenotypes: the role of the suppression effect.
25847144 2015 Association between the expression of T-cadherin and vascular endothelial growth factor and the prognosis of patients with gastric cancer.
25739828 2015 Cadherin-13 gene is associated with hyperactive/impulsive symptoms in attention/deficit hyperactivity disorder.
25735345 2015 Quantitative assessment of the diagnostic role of CDH13 promoter methylation in lung cancer.
25729143 2015 Genome-wide association study identifies three novel genetic markers associated with elite endurance performance.
25677746 2015 T-cadherin association with clinicopathological features and prognosis in axillary lymph node-positive breast cancer.
25543204 2015 CDH13 promoter SNPs with pleiotropic effect on cardiometabolic parameters represent methylation QTLs.
More...