Property Summary

NCBI Gene PubMed Count 22
PubMed Score 18.67
PubTator Score 12.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -2.900 4.8e-04
aldosterone-producing adenoma -1.954 3.4e-02
astrocytic glioma -2.700 7.9e-04
Astrocytoma, Pilocytic -3.600 1.6e-09
atypical teratoid / rhabdoid tumor -3.300 3.2e-04
Breast cancer -1.700 2.5e-29
ependymoma -3.100 8.6e-04
glioblastoma -3.000 1.3e-08
group 3 medulloblastoma -2.700 3.9e-03
lung cancer 1.600 1.7e-02
medulloblastoma, large-cell -2.200 1.3e-02
oligodendroglioma -2.500 3.5e-03
ovarian cancer -1.100 8.1e-04
primitive neuroectodermal tumor -3.000 3.2e-04
psoriasis -2.000 1.6e-70

Gene RIF (6)

AA Sequence

MLTRNCLSLLLWVLFDGGLLTPLQPQPQQTLATEPRENVIHLPGQRSHFQRVKRGWVWNQFFVLEEYVGS      1 - 70
EPQYVGKLHSDLDKGEGTVKYTLSGDGAGTVFTIDETTGDIHAIRSLDREEKPFYTLRAQAVDIETRKPL     71 - 140
EPESEFIIKVQDINDNEPKFLDGPYVATVPEMSPVGAYVLQVKATDADDPTYGNSARVVYSILQGQPYFS    141 - 210
IDPKTGVIRTALPNMDREVKEQYQVLIQAKDMGGQLGGLAGTTIVNITLTDVNDNPPRFPKSIFHLKVPE    211 - 280
SSPIGSAIGRIRAVDPDFGQNAEIEYNIVPGDGGNLFDIVTDEDTQEGVIKLKKPLDFETKKAYTFKVEA    281 - 350
SNLHLDHRFHSAGPFKDTATVKISVLDVDEPPVFSKPLYTMEVYEDTPVGTIIGAVTAQDLDVGSSAVRY    351 - 420
FIDWKSDGDSYFTIDGNEGTIATNELLDRESTAQYNFSIIASKVSNPLLTSKVNILINVLDVNEFPPEIS    421 - 490
VPYETAVCENAKPGQIIQIVSAADRDLSPAGQQFSFRLSPEAAIKPNFTVRDFRNNTAGIETRRNGYSRR    491 - 560
QQELYFLPVVIEDSSYPVQSSTNTMTIRVCRCDSDGTILSCNVEAIFLPVGLSTGALIAILLCIVILLAI    561 - 630
VVLYVALRRQKKKDTLMTSKEDIRDNVIHYDDEGGGEEDTQAFDIGALRNPKVIEENKIRRDIKPDSLCL    631 - 700
PRQRPPMEDNTDIRDFIHQRLQENDVDPTAPPYDSLATYAYEGSGSVAESLSSIDSLTTEADQDYDYLTD    701 - 770
WGPRFKVLADMFGEEESYNPDKVT                                                  771 - 794
//

Text Mined References (24)

PMID Year Title