Property Summary

NCBI Gene PubMed Count 21
Grant Count 1
Funding $62,836.5
PubMed Score 17.69
PubTator Score 12.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -2.700 0.001
ependymoma -3.300 0.000
oligodendroglioma -2.500 0.003
glioblastoma -4.000 0.000
group 3 medulloblastoma -2.700 0.004
atypical teratoid / rhabdoid tumor -3.300 0.000
medulloblastoma, large-cell -2.200 0.013
primitive neuroectodermal tumor -3.000 0.000
lung cancer 1.600 0.017
pediatric high grade glioma -3.200 0.000
pilocytic astrocytoma -3.600 0.000
aldosterone-producing adenoma -1.954 0.034
Breast cancer -1.700 0.000
ovarian cancer -1.100 0.001
psoriasis -2.000 0.000

Synonym

Accession P55289 B2RBT1 B7Z2U6 Q86UD2
Symbols CDHB

Gene

PANTHER Protein Class (2)

 Grant Application (1)

Gene RIF (5)

PMID Text
21573496 CDH12 may play an important role in the invasion and metastasis of salivary adenoid cystic carcinoma
20453000 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19567891 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19473719 E2F4, PHACTR3, PRAME family member and CDH12 most probably play important role in non-small-cell lung cancer geneses

AA Sequence

MLTRNCLSLLLWVLFDGGLLTPLQPQPQQTLATEPRENVIHLPGQRSHFQRVKRGWVWNQFFVLEEYVGS      1 - 70
EPQYVGKLHSDLDKGEGTVKYTLSGDGAGTVFTIDETTGDIHAIRSLDREEKPFYTLRAQAVDIETRKPL     71 - 140
EPESEFIIKVQDINDNEPKFLDGPYVATVPEMSPVGAYVLQVKATDADDPTYGNSARVVYSILQGQPYFS    141 - 210
IDPKTGVIRTALPNMDREVKEQYQVLIQAKDMGGQLGGLAGTTIVNITLTDVNDNPPRFPKSIFHLKVPE    211 - 280
SSPIGSAIGRIRAVDPDFGQNAEIEYNIVPGDGGNLFDIVTDEDTQEGVIKLKKPLDFETKKAYTFKVEA    281 - 350
SNLHLDHRFHSAGPFKDTATVKISVLDVDEPPVFSKPLYTMEVYEDTPVGTIIGAVTAQDLDVGSSAVRY    351 - 420
FIDWKSDGDSYFTIDGNEGTIATNELLDRESTAQYNFSIIASKVSNPLLTSKVNILINVLDVNEFPPEIS    421 - 490
VPYETAVCENAKPGQIIQIVSAADRDLSPAGQQFSFRLSPEAAIKPNFTVRDFRNNTAGIETRRNGYSRR    491 - 560
QQELYFLPVVIEDSSYPVQSSTNTMTIRVCRCDSDGTILSCNVEAIFLPVGLSTGALIAILLCIVILLAI    561 - 630
VVLYVALRRQKKKDTLMTSKEDIRDNVIHYDDEGGGEEDTQAFDIGALRNPKVIEENKIRRDIKPDSLCL    631 - 700
PRQRPPMEDNTDIRDFIHQRLQENDVDPTAPPYDSLATYAYEGSGSVAESLSSIDSLTTEADQDYDYLTD    701 - 770
WGPRFKVLADMFGEEESYNPDKVT                                                  771 - 794
//

Text Mined References (23)

PMID Year Title
24237488 2013 Cadherin-12 contributes to tumorigenicity in colorectal cancer by promoting migration, invasion, adhersion and angiogenesis.
23502783 2013 The CCND1 c.870G>A polymorphism is a risk factor for t(11;14)(q13;q32) multiple myeloma.
21573496 2011 CDH12 promotes the invasion of salivary adenoid cystic carcinoma.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19567891 2009 Genetic utility of broadly defined bipolar schizoaffective disorder as a diagnostic concept.
19557197 2009 NRXN3 is a novel locus for waist circumference: a genome-wide association study from the CHARGE Consortium.
19473719 2010 Identification of genes associated with non-small-cell lung cancer promotion and progression.
17608962 2008 Gene expression profiling of post-mortem orbitofrontal cortex in violent suicide victims.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...