Property Summary

NCBI Gene PubMed Count 20
PubMed Score 19.43
PubTator Score 9.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.900 1.6e-03
astrocytic glioma -1.700 4.9e-03
Astrocytoma, Pilocytic -2.000 4.8e-06
atypical teratoid / rhabdoid tumor -2.100 1.5e-05
cystic fibrosis -1.734 6.2e-03
ependymoma -1.900 4.6e-03
glioblastoma -1.800 5.2e-09
group 3 medulloblastoma -1.400 4.7e-02
malignant mesothelioma 2.400 3.6e-08
medulloblastoma, large-cell -2.100 8.9e-03
oligodendroglioma -1.600 1.2e-02
pituitary cancer 2.400 3.6e-06
primitive neuroectodermal tumor -1.600 3.4e-02

 CSPA Cell Line (2)

Gene RIF (5)

AA Sequence

MPERLAEMLLDLWTPLIILWITLPPCIYMAPMNQSQVLMSGSPLELNSLGEEQRILNRSKRGWVWNQMFV      1 - 70
LEEFSGPEPILVGRLHTDLDPGSKKIKYILSGDGAGTIFQINDVTGDIHAIKRLDREEKAEYTLTAQAVD     71 - 140
WETSKPLEPPSEFIIKVQDINDNAPEFLNGPYHATVPEMSILGTSVTNVTATDADDPVYGNSAKLVYSIL    141 - 210
EGQPYFSIEPETAIIKTALPNMDREAKEEYLVVIQAKDMGGHSGGLSGTTTLTVTLTDVNDNPPKFAQSL    211 - 280
YHFSVPEDVVLGTAIGRVKANDQDIGENAQSSYDIIDGDGTALFEITSDAQAQDGIIRLRKPLDFETKKS    281 - 350
YTLKVEAANVHIDPRFSGRGPFKDTATVKIVVEDADEPPVFSSPTYLLEVHENAALNSVIGQVTARDPDI    351 - 420
TSSPIRFSIDRHTDLERQFNINADDGKITLATPLDRELSVWHNITIIATEIRNHSQISRVPVAIKVLDVN    421 - 490
DNAPEFASEYEAFLCENGKPGQVIQTVSAMDKDDPKNGHYFLYSLLPEMVNNPNFTIKKNEDNSLSILAK    491 - 560
HNGFNRQKQEVYLLPIIISDSGNPPLSSTSTLTIRVCGCSNDGVVQSCNVEAYVLPIGLSMGALIAILAC    561 - 630
IILLLVIVVLFVTLRRHKNEPLIIKDDEDVRENIIRYDDEGGGEEDTEAFDIATLQNPDGINGFLPRKDI    631 - 700
KPDLQFMPRQGLAPVPNGVDVDEFINVRLHEADNDPTAPPYDSIQIYGYEGRGSVAGSLSSLESTTSDSD    701 - 770
QNFDYLSDWGPRFKRLGELYSVGESDKET                                             771 - 799
//

Text Mined References (20)

PMID Year Title