Property Summary

NCBI Gene PubMed Count 53
PubMed Score 52.14
PubTator Score 69.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Stomach Neoplasms 282
Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.39584072809223E-8
pilocytic astrocytoma 3086 7.00150230718467E-8
glioblastoma 5572 3.87227084618267E-7
medulloblastoma, large-cell 6234 4.60433107676221E-7
adult high grade glioma 2148 2.26754282473753E-6
tuberculosis and treatment for 3 months 327 4.53215650557502E-6
Breast cancer 3099 8.96461144031149E-6
medulloblastoma 1524 8.0114576207136E-5
astrocytic glioma 2241 0.00531360316764988
ependymoma 2514 0.00832754400805467
oligodendroglioma 2849 0.0130682624251246
Disease Target Count Z-score Confidence
Cancer 2346 3.537 1.8

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.200 0.005
ependymoma -2.400 0.008
oligodendroglioma -2.000 0.013
glioblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -2.600 0.000
medulloblastoma -1.300 0.000
medulloblastoma, large-cell -2.700 0.000
tuberculosis and treatment for 3 months 1.400 0.000
adult high grade glioma -2.500 0.000
pilocytic astrocytoma -1.900 0.000
Breast cancer 1.800 0.000

Synonym

Accession P55273 Q13102 Q6FGE9
Symbols p19
INK4D
p19-INK4D

Gene

PDB

1BI8   1BD8  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (32)

PMID Text
26019450 MiR-451 inhibited the proliferation of esophageal squamous cell carcinoma cells by targeting CDKN2D and MAP3K1 expression.
25275592 CDKN2D repression by PML/RARalpha disrupts both cell proliferation and differentiation in the pathogenesis of acute promyelocytic leukemia.
25204969 Data indicate that upon oxidative DNA damage, cyclin-dependent kinase inhibitor p19INK4d strongly binds to and relaxes chromatin.
25104850 p19-INK4d inhibits neuroblastoma cell growth, induces differentiation and is hypermethylated and downregulated in MYCN-amplified neuroblastomas.
24675677 CDKN2D-WDFY2 fusion could be an important molecular signature for understanding and classifying sub-lineages among heterogeneous high-grade serous ovarian carcinomas.
24127162 Mutations in CDKN2D is associated with sporadic parathyroid adenoma.
24022213 P19(INK4d) expression is a poor prognostic factor in ovarian cancer patients.
23536791 PTB plays as a negative regulator in H1299 cell proliferation at least by inducing p19(Ink4d) expression at transcriptional and post-transcriptional levels.
22747700 Up-regulation of CDKN2D during in-vitro passages of human amniotic fluid-derived mesenchymal stromal cells may indicate the begging of early senescence process in a p53-independent mechanism.
22558186 CDK2 and PKA mediated-sequential phosphorylation is critical for p19INK4d function in the DNA damage response to ensure cell survival.
More...

AA Sequence

MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQ      1 - 70
DTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGL     71 - 140
TPLELALQRGAQDLVDILQGHMVAPL                                                141 - 166
//

Text Mined References (55)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26019450 2015 MiR-451 inhibits proliferation of esophageal carcinoma cell line EC9706 by targeting CDKN2D and MAP3K1.
25416956 2014 A proteome-scale map of the human interactome network.
25275592 2014 Transcriptional repression of CDKN2D by PML/RAR? contributes to the altered proliferation and differentiation block of acute promyelocytic leukemia cells.
25204969 2015 Nuclear translocation of p19INK4d in response to oxidative DNA damage promotes chromatin relaxation.
25104850 2014 p19-INK4d inhibits neuroblastoma cell growth, induces differentiation and is hypermethylated and downregulated in MYCN-amplified neuroblastomas.
24675677 2014 CDKN2D-WDFY2 is a cancer-specific fusion gene recurrent in high-grade serous ovarian carcinoma.
24127162 2013 Mutations in CDKN2C (p18) and CDKN2D (p19) may cause sporadic parathyroid adenoma.
24022213 2013 p19(INK4d) mRNA and protein expression as new prognostic factors in ovarian cancer patients.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
More...