Property Summary

NCBI Gene PubMed Count 57
PubMed Score 53.07
PubTator Score 69.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.500 2.3e-06
astrocytic glioma -2.200 5.3e-03
Astrocytoma, Pilocytic -1.900 6.6e-08
atypical teratoid / rhabdoid tumor -2.600 1.4e-08
Breast cancer 1.800 9.0e-06
ependymoma -2.400 8.3e-03
glioblastoma -1.600 3.6e-06
medulloblastoma -1.300 8.0e-05
medulloblastoma, large-cell -2.700 4.6e-07
oligodendroglioma -2.000 1.3e-02
tuberculosis 1.300 1.0e-05

Protein-protein Interaction (6)

Gene RIF (35)

AA Sequence

MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQ      1 - 70
DTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGL     71 - 140
TPLELALQRGAQDLVDILQGHMVAPL                                                141 - 166
//

Text Mined References (59)

PMID Year Title