Property Summary

NCBI Gene PubMed Count 55
PubMed Score 131.69
PubTator Score 48.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Endometrial cancer 311 0.0 0.6
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Familial nephrotic syndrome 6 0.0 5.0
Disease Target Count Z-score Confidence
Ecthyma 2 3.859 1.9
Gastric outlet obstruction 6 3.117 1.6

Expression

  Differential Expression (17)

Disease log2 FC p
active ulcerative colitis 1.594 1.1e-02
astrocytoma 1.200 4.2e-16
Astrocytoma, Pilocytic 1.500 1.3e-06
atypical teratoid / rhabdoid tumor 1.900 3.0e-06
cystic fibrosis -1.100 7.7e-05
ependymoma 1.200 1.0e-02
glioblastoma 1.100 8.4e-04
group 4 medulloblastoma -1.200 8.3e-04
invasive ductal carcinoma -2.000 8.6e-04
lung carcinoma -1.400 3.9e-18
malignant mesothelioma -1.100 2.0e-05
ovarian cancer 1.900 4.9e-05
pancreatic cancer 1.200 2.0e-03
pediatric high grade glioma 1.200 5.1e-05
primary pancreatic ductal adenocarcinoma 1.144 4.3e-03
psoriasis -1.200 2.1e-08
subependymal giant cell astrocytoma 1.775 1.5e-02

 GWAS Trait (1)

 CSPA Cell Line (3)

Protein-protein Interaction (5)

Gene RIF (28)

AA Sequence

MELTSRERGRGQPLPWELRLGLLLSVLAATLAQAPAPDVPGCSRGSCYPATGDLLVGRADRLTASSTCGL      1 - 70
NGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPHSHRIQNVVTSFAPQRRAAWWQSENGIPAVTIQLDLE     71 - 140
AEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSYDCGADFPGVPLAPPRHWDDVVCESRYSEIE    141 - 210
PSTEGEVIYRVLDPAIPIPDPYSSRIQNLLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVR    211 - 280
GNCFCYGHASECAPAPGAPAHAEGMVHGACICKHNTRGLNCEQCQDFYRDLPWRPAEDGHSHACRKCECH    281 - 350
GHTHSCHFDMAVYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDLRDPAVCRSCDCDPMGSQDG    351 - 420
GRCDSHDDPALGLVSGQCRCKEHVVGTRCQQCRDGFFGLSISDRLGCRRCQCNARGTVPGSTPCDPNSGS    421 - 490
CYCKRLVTGRGCDRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCDEGTGQCHCRQHMVGRRCEQVQPGYF    491 - 560
RPFLDHLIWEAEDTRGQVLDVVERLVTPGETPSWTGSGFVRLQEGQTLEFLVASVPKAMDYDLLLRLEPQ    561 - 630
VPEQWAELELIVQRPGPVPAHSLCGHLVPKDDRIQGTLQPHARYLIFPNPVCLEPGISYKLHLKLVRTGG    631 - 700
SAQPETPYSGPGLLIDSLVLLPRVLVLEMFSGGDAAALERQATFERYQCHEEGLVPSKTSPSEACAPLLI    701 - 770
SLSTLIYNGALPCQCNPQGSLSSECNPHGGQCLCKPGVVGRRCDLCAPGYYGFGPTGCQACQCSHEGALS    771 - 840
SLCEKTSGQCLCRTGAFGLRCDRCQRGQWGFPSCRPCVCNGHADECNTHTGACLGCRDHTGGEHCERCIA    841 - 910
GFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHQDEYSQQIVCHCRAGYTGLRCEACAPGHFGDPSRPG    911 - 980
GRCQLCECSGNIDPMDPDACDPHTGQCLRCLHHTEGPHCAHCKPGFHGQAARQSCHRCTCNLLGTNPQQC    981 - 1050
PSPDQCHCDPSSGQCPCLPNVQGPSCDRCAPNFWNLTSGHGCQPCACHPSRARGPTCNEFTGQCHCRAGF   1051 - 1120
GGRTCSECQELHWGDPGLQCHACDCDSRGIDTPQCHRFTGHCSCRPGVSGVRCDQCARGFSGIFPACHPC   1121 - 1190
HACFGDWDRVVQDLAARTQRLEQRAQELQQTGVLGAFESSFWHMQEKLGIVQGIVGARNTSAASTAQLVE   1191 - 1260
ATEELRREIGEATEHLTQLEADLTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDLLKHSNFLGAY   1261 - 1330
DSIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFNSKHMANQRALGKLSAHTHTL   1331 - 1400
SLTDINELVCGAPGDAPCATSPCGGAGCRDEDGQPRCGGLSCNGAAATADLALGRARHTQAELQRALAEG   1401 - 1470
GSILSRVAETRRQASEAQQRAQAALDKANASRGQVEQANQELQELIQSVKDFLNQEGADPDSIEMVATRV   1471 - 1540
LELSIPASAEQIQHLAGAIAERVRSLADVDAILARTVGDVRRAEQLLQDARRARSWAEDEKQKAETVQAA   1541 - 1610
LEEAQRAQGIAQGAIRGAVADTRDTEQTLYQVQERMAGAERALSSAGERARQLDALLEALKLKRAGNSLA   1611 - 1680
ASTAEETAGSAQGRAQEAEQLLRGPLGDQYQTVKALAERKAQGVLAAQARAEQLRDEARDLLQAAQDKLQ   1681 - 1750
RLQELEGTYEENERALESKAAQLDGLEARMRSVLQAINLQVQIYNTCQ                         1751 - 1798
//

Text Mined References (59)

PMID Year Title