Property Summary

NCBI Gene PubMed Count 180
Grant Count 309
R01 Count 199
Funding $36,801,124
PubMed Score 714.76
PubTator Score 458.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.316 0.005
cutaneous lupus erythematosus 1.200 0.000
astrocytoma 1.300 0.003
Duchenne muscular dystrophy 1.043 0.000
juvenile dermatomyositis 2.511 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.002
breast carcinoma 1.100 0.001
ovarian cancer 1.800 0.000
dermatomyositis 2.200 0.000

Synonym

Accession P55265 B1AQQ9 B1AQR0 D3DV76 O15223 O43859 O43860 Q9BYM3 Q9BYM4 DRADA
Symbols DSH
AGS6
G1P1
IFI4
P136
ADAR1
DRADA
DSRAD
IFI-4
K88DSRBP

Gene

PDB

1QBJ   1QGP   1XMK   2ACJ   2GXB   2L54   2MDR   3F21   3F22   3F23   3IRQ   3IRR  

Gene RIF (155)

PMID Text
27060309 The frame-shift mutation c.2638delG and the nonsense mutation c.2867C>A in the ADAR1 gene are associated with the dyschromatosis symmetrica hereditaria.
26892242 A three-generation family exhibiting phenotypic variability with a single germline ADAR1 mutation suggests that chilblain might aggravate the clinical phenotypes of dyschromatosis symmetrica hereditaria.
26817845 ADAR1 p150 as the major A-to-I editor in mouse embryo fibroblasts.
26658668 Recent research has demonstrated that inosine in the epitranscriptome and ADAR1 protein establish innate immune tolerance for host dsRNA formed by endogenous sequences.
26655226 A-to-I RNA editing levels catalyzed by ADAR1 and ADARB1 decreased in Alzheimer's disease patients' brain tissues, mainly in the hippocampus and to a lesser degree in the temporal and frontal lobes.
26485095 These findings suggest that adenosine deaminase acting on RNA 1 is subject to different regulations by DNA methyltransferase and histone deacetylase enzymes in neuronal SH-SY5Y cells.
26363218 our data originally support the evidence that ADAR1 can be part of the cell protein array uploaded in HIV-1 particles.
26363218 p55 Gag associates with ADAR1
26338962 ADAR1, in an editing-independent manner, regulates the biogenesis of miR-222 at the transcription level and thereby ICAM1 expression, which consequently affects melanoma immune resistance.
26335850 transcriptional activation of Adar1 by IFN occurs in the absence of STAT1 by a non-canonical STAT2-dependent pathway in mouse but not human cells.
More...

AA Sequence

MNPRQGYSLSGYYTHPFQGYEHRQLRYQQPGPGSSPSSFLLKQIEFLKGQLPEAPVIGKQTPSLPPSLPG      1 - 70
LRPRFPVLLASSTRGRQVDIRGVPRGVHLRSQGLQRGFQHPSPRGRSLPQRGVDCLSSHFQELSIYQDQE     71 - 140
QRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVSTQAWNQHSGV    141 - 210
VRPDGHSQGAPNSDPSLEPEDRNSTSVSEDLLEPFIAVSAQAWNQHSGVVRPDSHSQGSPNSDPGLEPED    211 - 280
SNSTSALEDPLEFLDMAEIKEKICDYLFNVSDSSALNLAKNIGLTKARDINAVLIDMERQGDVYRQGTTP    281 - 350
PIWHLTDKKRERMQIKRNTNSVPETAPAAIPETKRNAEFLTCNIPTSNASNNMVTTEKVENGQEPVIKLE    351 - 420
NRQEARPEPARLKPPVHYNGPSKAGYVDFENGQWATDDIPDDLNSIRAAPGEFRAIMEMPSFYSHGLPRC    421 - 490
SPYKKLTECQLKNPISGLLEYAQFASQTCEFNMIEQSGPPHEPRFKFQVVINGREFPPAEAGSKKVAKQD    491 - 560
AAMKAMTILLEEAKAKDSGKSEESSHYSTEKESEKTAESQTPTPSATSFFSGKSPVTTLLECMHKLGNSC    561 - 630
EFRLLSKEGPAHEPKFQYCVAVGAQTFPSVSAPSKKVAKQMAAEEAMKALHGEATNSMASDNQPEGMISE    631 - 700
SLDNLESMMPNKVRKIGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFP    701 - 770
AVCAHSKKQGKQEAADAALRVLIGENEKAERMGFTEVTPVTGASLRRTMLLLSRSPEAQPKTLPLTGSTF    771 - 840
HDQIAMLSHRCFNTLTNSFQPSLLGRKILAAIIMKKDSEDMGVVVSLGTGNRCVKGDSLSLKGETVNDCH    841 - 910
AEIISRRGFIRFLYSELMKYNSQTAKDSIFEPAKGGEKLQIKKTVSFHLYISTAPCGDGALFDKSCSDRA    911 - 980
MESTESRHYPVFENPKQGKLRTKVENGEGTIPVESSDIVPTWDGIRLGERLRTMSCSDKILRWNVLGLQG    981 - 1050
ALLTHFLQPIYLKSVTLGYLFSQGHLTRAICCRVTRDGSAFEDGLRHPFIVNHPKVGRVSIYDSKRQSGK   1051 - 1120
TKETSVNWCLADGYDLEILDGTRGTVDGPRNELSRVSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAAR   1121 - 1190
DYETAKNYFKKGLKDMGYGNWISKPQEEKNFYLCPV                                     1191 - 1226
//

Text Mined References (200)

PMID Year Title
27060309 2016 [Two novel mutations of the ADAR1 gene associated with dyschromatosis symmetrica hereditaria].
26892242 2016 Genetic spectrum of dyschromatosis symmetrica hereditaria in Chinese patients including a novel nonstop mutation in ADAR1 gene.
26817845 2016 Editing of Cellular Self-RNAs by Adenosine Deaminase ADAR1 Suppresses Innate Immune Stress Responses.
26658668 2015 The Epitranscriptome and Innate Immunity.
26655226 2016 Reduced levels of protein recoding by A-to-I RNA editing in Alzheimer's disease.
26485095 2015 Differential regulation of expression of RNA-editing enzymes, ADAR1 and ADAR2, by 5-aza-2'-deoxycytidine and trichostatin A in human neuronal SH-SY5Y cells.
26363218 2015 The ADAR1 editing enzyme is encapsidated into HIV-1 virions.
26338962 2015 A novel immune resistance mechanism of melanoma cells controlled by the ADAR1 enzyme.
26335850 2015 STAT2-dependent induction of RNA adenosine deaminase ADAR1 by type I interferon differs between mouse and human cells in the requirement for STAT1.
26084202 2015 Loss of ADAR1 in human iPS cells promotes caspase3-mediated apoptotic cell death.
More...