Property Summary

NCBI Gene PubMed Count 34
Grant Count 134
R01 Count 99
Funding $20,537,299.71
PubMed Score 323.45
PubTator Score 225.86

Knowledge Summary

Patent (25,369)

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.844 0.000
Multiple myeloma 1.178 0.013
urothelial carcinoma -1.100 0.039
esophageal adenocarcinoma -1.300 0.020
ependymoma 1.100 0.007
glioblastoma 1.100 0.039
medulloblastoma, large-cell 1.300 0.027
pancreatic ductal adenocarcinoma liver m... -2.404 0.001
lung cancer 1.600 0.002
pediatric high grade glioma 1.300 0.014
pilocytic astrocytoma 1.100 0.015
ovarian cancer 1.500 0.000

Synonym

Gene

ADK

PANTHER Protein Class (3)

PDB

1BX4   2I6A   2I6B   4O1L  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (16)

PMID Text
26329539 ADA and ADK are involved in glioma progression; increased ADA and ADK levels in peritumoral tissues may be associated with epilepsy in glioma patients.
26040919 rs11001109 rare allele homozygosity is associated with increased risk of post-traumatic epilepsy development after brain injury.
25575137 The results of this study suggest that upregulation of ADK is a common pathologic component of FCDIIB.
24128682 These results suggest that upregulation of ADK is a common pathologic hallmark of Rasmussen encephalitis and that ADK might be a target in the treatment of epilepsy associated with Rasmussen encephalitis.
22092111 Data show that we a significantly higher expression of ADK in the peritumoral infiltrated tissue of patients with epilepsy than in patients without epilepsy.
21635241 The results of this study suggested that dysregulation of ADK in astrocytes is a common pathologic hallmark of temporal lobe epilepsy.
20881134 The cytoplasmic isoform of adenosine kinase is sufficient to alter sleep physiology. ADK might orchestrate neurotransmitter pathways involved in the generation of electroencephlogram oscillations and regulation of sleep.
20698827 The catalytic properties, gene expression and protein levels of certain proteins involved in mitochondrial ATP synthesis, such as F1F0-ATPase, ANT and AK, in human skin fibroblasts with trisomic karyotype, compared them with euploid fibroblasts.
20392501 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAAAEEEPKPKKLKVEAPQALRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELV      1 - 70
KKFKVEYHAGGSTQNSIKVAQWMIQQPHKAATFFGCIGIDKFGEILKRKAAEAHVDAHYYEQNEQPTGTC     71 - 140
AACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVEKARVCYIAGFFLTVSPESVLKVAHHASENNRIF    141 - 210
TLNLSAPFISQFYKESLMKVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVI    211 - 280
FTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRR    281 - 350
TGCTFPEKPDFH                                                              351 - 362
//

Text Mined References (41)

PMID Year Title
26329539 2015 Adenosine deaminase and adenosine kinase expression in human glioma and their correlation with glioma?associated epilepsy.
26040919 2015 Genetic variation in the adenosine regulatory cycle is associated with posttraumatic epilepsy development.
25575137 2015 Adenosine kinase expression in cortical dysplasia with balloon cells: analysis of developmental lineage of cell types.
25108383 2014 Genome-wide association analyses identify variants in developmental genes associated with hypospadias.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24128682 2013 Upregulation of adenosine kinase in Rasmussen encephalitis.
23704328 2013 Genome-wide association study of primary tooth eruption identifies pleiotropic loci associated with height and craniofacial distances.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22092111 2012 Overexpression of ADK in human astrocytic tumors and peritumoral tissue is related to tumor-associated epilepsy.
More...