Property Summary

NCBI Gene PubMed Count 30
PubMed Score 430.11
PubTator Score 215.05

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

AA Sequence

MPHLMERMVGSGLLWLALVSCILTQASAVQRGYGNPIEASSYGLDLDCGAPGTPEAHVCFDPCQNYTLLD      1 - 70
EPFRSTENSAGSQGCDKNMSGWYRFVGEGGVRMSETCVQVHRCQTDAPMWLNGTHPALGDGITNHTACAH     71 - 140
WSGNCCFWKTEVLVKACPGGYHVYRLEGTPWCNLRYCTVPRDPSTVEDKCEKACRPEEECLALNSTWGCF    141 - 210
CRQDLNSSDVHSLQPQLDCGPREIKVKVDKCLLGGLGLGEEVIAYLRDPNCSSILQTEERNWVSVTSPVQ    211 - 280
ASACRNILERNQTHAIYKNTLSLVNDFIIRDTILNINFQCAYPLDMKVSLQAALQPIVSSLNVSVDGNGE    281 - 350
FIVRMALFQDQNYTNPYEGDAVELSVESVLYVGAILEQGDTSRFNLVLRNCYATPTEDKADLVKYFIIRN    351 - 420
SCSNQRDSTIHVEENGQSSESRFSVQMFMFAGHYDLVFLHCEIHLCDSLNEQCQPSCSRSQVRSEVPAID    421 - 490
LARVLDLGPITRRGAQSPGVMNGTPSTAGFLVAWPMVLLTVLLAWLF                           491 - 537
//

Text Mined References (31)

PMID Year Title