Property Summary

NCBI Gene PubMed Count 29
Grant Count 115
R01 Count 76
Funding $20,024,661.82
PubMed Score 394.35
PubTator Score 215.05

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P55259 A6NFM9 A6NJA8 Q13338 Q9UIF1
Symbols ZAP75

Gene

GP2

Gene RIF (12)

PMID Text
25968583 Totals of 12.4% and 20.8% of Crohn's disease patients were positive for IgA/IgG type of anti-GP2 and anti-CUZD1, respectively. Positivity for anti-pancreatic autoantibodies predicted a faster progression towards complicated disease course.
23118780 Anti-GP2 antibody positive CD patients had higher ASCA titres compared to seronegative cases.
22891285 A novel role for GP2 in immune regulation could provide a platform for new therapeutic interventions in the treatment of Crohn disease.
21190681 GP2 is a binding partner of the scavenger receptor expressed on endothelial cells I (SREC-I) but not of SR-AI and SR-BI. Dendritic cells express SREC-I and also bind and internalize GP2.
20335779 GP2 gene is unlikely to play a major role in the etiology of chronic pancreatitis.
20335779 Observational study of gene-disease association. (HuGE Navigator)
19959969 Data suggest that GP2 alterations do not alter the risk for the development of chronic pancreatitis.
19959969 Observational study of gene-disease association. (HuGE Navigator)
19919903 This study represents the first detailed analysis of any variation in the GP2 gene and gives some support to the putative association of c.1275A>G with chronic pancreatitis disease protection.
19907495 glycoprotein 2 (GP2), specifically expressed on the apical plasma membrane of M cells among enterocytes, serves as a transcytotic receptor for mucosal antigens
More...

AA Sequence

MPHLMERMVGSGLLWLALVSCILTQASAVQRGYGNPIEASSYGLDLDCGAPGTPEAHVCFDPCQNYTLLD      1 - 70
EPFRSTENSAGSQGCDKNMSGWYRFVGEGGVRMSETCVQVHRCQTDAPMWLNGTHPALGDGITNHTACAH     71 - 140
WSGNCCFWKTEVLVKACPGGYHVYRLEGTPWCNLRYCTVPRDPSTVEDKCEKACRPEEECLALNSTWGCF    141 - 210
CRQDLNSSDVHSLQPQLDCGPREIKVKVDKCLLGGLGLGEEVIAYLRDPNCSSILQTEERNWVSVTSPVQ    211 - 280
ASACRNILERNQTHAIYKNTLSLVNDFIIRDTILNINFQCAYPLDMKVSLQAALQPIVSSLNVSVDGNGE    281 - 350
FIVRMALFQDQNYTNPYEGDAVELSVESVLYVGAILEQGDTSRFNLVLRNCYATPTEDKADLVKYFIIRN    351 - 420
SCSNQRDSTIHVEENGQSSESRFSVQMFMFAGHYDLVFLHCEIHLCDSLNEQCQPSCSRSQVRSEVPAID    421 - 490
LARVLDLGPITRRGAQSPGVMNGTPSTAGFLVAWPMVLLTVLLAWLF                           491 - 537
//

Text Mined References (30)

PMID Year Title
25968583 2015 Rediscovery of the Anti-Pancreatic Antibodies and Evaluation of their Prognostic Value in a Prospective Clinical Cohort of Crohn's Patients: The Importance of Specific Target Antigens [GP2 and CUZD1].
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23118780 2012 Ileal inflammation may trigger the development of GP2-specific pancreatic autoantibodies in patients with Crohn's disease.
22891285 2012 Identification of pancreatic glycoprotein 2 as an endogenous immunomodulator of innate and adaptive immune responses.
22344219 2012 Meta-analysis identifies common variants associated with body mass index in east Asians.
21190681 2011 The zymogen granule protein 2 (GP2) binds to scavenger receptor expressed on endothelial cells I (SREC-I).
20383146 2010 New loci associated with kidney function and chronic kidney disease.
20335779 2010 Genetic analysis of the glycoprotein 2 gene in patients with chronic pancreatitis.
19959969 2010 Mutational analysis of the gene encoding the zymogen granule membrane glycoprotein 2 (GP2) in patients with chronic pancreatitis.
More...