Property Summary

Ligand Count 61
NCBI Gene PubMed Count 120
PubMed Score 293.63
PubTator Score 233.29

Knowledge Summary

Patent

No data available

Expression

 GO Component (2)

Gene RIF (67)

AA Sequence

MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCAD      1 - 70
RDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLT     71 - 140
GLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCY    141 - 210
SVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFAS    211 - 280
MLTKKLHFFPKSN                                                             281 - 293
//

Text Mined References (122)

PMID Year Title