Property Summary

NCBI Gene PubMed Count 111
Grant Count 74
R01 Count 51
Funding $7,983,621.43
PubMed Score 276.94
PubTator Score 233.29

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P55212 Q9BQE7 CASP-6
Symbols MCH2

Gene

PDB

1MI9   2WDP   3K7E   3NKF   3NR2   3OD5   3P45   3P4U   3QNW   3S70   3S8E   3V6L   3V6M   4EJF   4FXO   4HVA   4IYR   4N5D   4N6G   4N7J   4N7M   4NBK   4NBL   4NBN  

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
686996 screening 1854 / 3 / 346159 VEID(2) R110 Enzymatic Primary HTS to identify Inhibitors of Caspase 6 Measured in Biochemical System Using Plate Reader - 7052-01_Inhibitor_SinglePoint_HTS_Activity_Set2
687025 summary 0 / 0 / 0 Broad Institute Inhibitors of Caspase 6 Inhibitor Probe Project
720632 confirmatory 443 / 1 / 519 VEID(2) R110 Enzymatic Primary HTS to identify Inhibitors of Caspase 6 Measured in Biochemical System Using Plate Reader - 7052-01_Inhibitor_Dose_CherryPick_Activity
743332 confirmatory 3 / 0 / 31 VEID(2) R110 Enzymatic Primary HTS to identify Inhibitors of Caspase 6 Measured in Biochemical System Using Plate Reader - 7052-01_Inhibitor_Dose_DryPowder_Activity

Gene RIF (62)

PMID Text
26505998 The ability of sox11 to reduce effector caspase activity was also reflected in its capacity to reduce cell death following toxic insult. Interestingly, other sox proteins also had the ability to reduce caspase-6 activity but to a lesser extent than sox11
24810717 unmodified STAT1 is cleaved at multiple sites by caspase-3 and caspase-6 in malignant undifferentiated hematopoietic cells
24727569 axon regeneration promoted by suppression of CASP2 and CASP6 is CNTF-dependent and mediated through the JAK/STAT signalling pathway
24419379 In this study, the crystal structure of a full-length CASP6 zymogen mutant, proCASP6H121A, was solved.
24363090 Caspase-6 plays a role in activating caspase-3 in Tau truncation.
24265764 Caspase-6 is likely important in most tissues during early development but is less involved in adult tissues
24070868 p53 activity is an important upstream regulator of caspase-6 activity in Huntington's disease.
24058506 Significant associations have been found between CpG sites and patient sex, including DNA methylation in CASP6, a gene that may respond to estradiol treatment, and in HSD17B12, which encodes a sex steroid hormone.
23402898 Caspase 6 activity in entorhinal cortex identifies aged individuals at risk for developing Alzheimer's disease.
22891250 binding of zinc at the exosite is the primary route of inhibition, potentially locking caspase-6 into the inactive helical conformation.
More...

AA Sequence

MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCAD      1 - 70
RDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLT     71 - 140
GLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCY    141 - 210
SVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFAS    211 - 280
MLTKKLHFFPKSN                                                             281 - 293
//

Text Mined References (113)

PMID Year Title
26505998 2015 Sox11 Reduces Caspase-6 Cleavage and Activity.
25416956 2014 A proteome-scale map of the human interactome network.
24810717 2014 Caspase-3 and caspase-6 cleave STAT1 in leukemic cells.
24727569 2014 Combined suppression of CASP2 and CASP6 protects retinal ganglion cells from apoptosis and promotes axon regeneration through CNTF-mediated JAK/STAT signalling.
24419379 2014 The regulatory mechanism of the caspase 6 pro-domain revealed by crystal structure and biochemical assays.
24363090 2014 A synergic role of caspase-6 and caspase-3 in Tau truncation at D421 induced by H2O 2.
24265764 2013 Expression and activation of caspase-6 in human fetal and adult tissues.
24070868 2014 p53 increases caspase-6 expression and activation in muscle tissue expressing mutant huntingtin.
24058506 2013 Genetic effects on DNA methylation and its potential relevance for obesity in Mexican Americans.
23402898 2013 Caspase-6 activity predicts lower episodic memory ability in aged individuals.
More...