Property Summary

NCBI Gene PubMed Count 298
Grant Count 511
R01 Count 366
Funding $36,293,762.45
PubMed Score 2135.89
PubTator Score 1651.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
adrenocortical carcinoma -2.692 0.000
tuberculosis -1.100 0.000

Synonym

Accession P55211 B4E1A3 O95348 Q53Y70 Q5JRU9 Q5UGI1 Q92852 Q9BQ62 Q9UEQ3 Q9UIJ8 CASP-9
Symbols MCH6
APAF3
APAF-3
PPP1R56
ICE-LAP6

Gene

PDB

3D9T   1NW9   3YGS   4RHW   1JXQ   2AR9   3V3K  

Gene RIF (280)

PMID Text
27141571 Renal CASP9 expression is increased in diabetes and increased as diabetic nephropathy progressed.
26323553 Results show that mRNA and protein levels of HAX-1 in prostate cancer cell lines were significantly higher and inhibits cell apoptosis through caspase-9 inactivation.
26290316 Inhibition of Caspase-9 restricted, while Apaf-1 promoted, Chlamydia pneumoniae infection in HEp-2, HeLa, and mouse epithelial fibroblast (MEF) cells.
26024713 interaction of rmEMMPRINex with U937 cells leads to inhibition of MCT1 membrane expression, intracellular activation of procaspase-9, followed by DNA fragmentation and apoptosis.
26014377 Inhibition of Mcl-1 and activation of caspases are critically involved in gallotannin-induced apoptosis in prostate cancer cells.
25815518 VPA and ATO had synergistic effects on the proliferation of RPMI8226 cells, which may have been associated with the decreased expression of Bcl-2 and the increased expression levels of Bcl-2-associated X protein, Caspase 8 and Caspase 9
25665064 Silver nanoparticles biosynthesized using Achillea biebersteinii flower extract: apoptosis induction in MCF-7 cells via caspase activation and regulation of Bax and Bcl-2 gene expression.
25569260 Expression of mutant caspase-9 correlated with a downregulation of BAFFR (B-cell-activating factor belonging to the TNF family (BAFF) receptor) in B cells and ICOS (inducible T-cell costimulator) in T cells.
25370148 Levels of caspase-9, caspase-10, MAVS, and pIRF7 in mononuclear cells and the disease activity index (SLEDAI) in the systemic lupus erythematosus patients were determined.
25356864 caspase-9 mediates Puma activation to determine the threshold for overcoming chemoresistance in cancer cells.
More...

AA Sequence

MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLIIDLETRGSQAL      1 - 70
PLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEVLRPETPRPVDIGSGGFGDVG     71 - 140
ALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHFMVEVKGDLTAK    141 - 210
KMVLALLELAQQDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPK    211 - 280
LFFIQACGGEQKDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPG    281 - 350
FVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS        351 - 416
//

Text Mined References (306)

PMID Year Title
27141571 Immunohistochemical Aspects of Cell Death in Diabetic Nephropathy.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26323553 2015 HAX-1 inhibits apoptosis in prostate cancer through the suppression of caspase-9 activation.
26290316 2015 An epistatic effect of apaf-1 and caspase-9 on chlamydial infection.
26024713 2015 Recombinant Multivalent EMMPRIN Extracellular Domain Induces U937 Human Leukemia Cell Apoptosis by Downregulation of Monocarboxylate Transporter 1 and Activation of Procaspase-9.
26014377 2015 Inhibition of Myeloid Cell Leukemia 1 and Activation of Caspases Are Critically Involved in Gallotannin-induced Apoptosis in Prostate Cancer Cells.
25815518 2015 Synergistic effects of valproic acid and arsenic trioxide on RPMI8226 cells in vitro and the possible underlying mechanisms.
25665064 2015 Silver nanoparticles biosynthesized using Achillea biebersteinii flower extract: apoptosis induction in MCF-7 cells via caspase activation and regulation of Bax and Bcl-2 gene expression.
25569260 2015 A mutation in caspase-9 decreases the expression of BAFFR and ICOS in patients with immunodeficiency and lymphoproliferation.
25416956 2014 A proteome-scale map of the human interactome network.
More...