Property Summary

Ligand Count 325
NCBI Gene PubMed Count 178
PubMed Score 418.12
PubTator Score 355.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Barrett's esophagus 1.700 2.0e-02
colon cancer -1.100 2.4e-04
esophageal adenocarcinoma 1.300 2.8e-02
group 3 medulloblastoma -1.100 3.3e-02
intraductal papillary-mucinous carcinoma... 1.700 3.9e-04
intraductal papillary-mucinous neoplasm ... 1.300 1.3e-02
juvenile dermatomyositis 1.148 1.6e-09
lung carcinoma -1.200 7.9e-20
medulloblastoma, large-cell -1.100 8.7e-03
pediatric high grade glioma 1.100 6.7e-04
psoriasis 1.100 2.1e-107

 GWAS Trait (2)

Gene RIF (105)

AA Sequence

MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKC      1 - 70
IIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACI     71 - 140
LLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPR    141 - 210
YKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDP    211 - 280
HFHEKKQIPCVVSMLTKELYFSQ                                                   281 - 303
//

Text Mined References (187)

PMID Year Title