Property Summary

NCBI Gene PubMed Count 168
Grant Count 72
R01 Count 41
Funding $5,387,086.43
PubMed Score 397.09
PubTator Score 355.55

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P55210 B4DQU7 B5BU45 D3DRB8 Q13364 Q53YD5 Q5SVL0 Q5SVL3 Q96BA0 CASP-7
Symbols MCH3
CMH-1
LICE2
CASP-7
ICE-LAP3

Gene

PDB

1I4O   1I51   1KMC   1F1J   1GQF   1K86   1K88   1MIA   1SHJ   1SHL   2QL5   2QL7   2QL9   2QLB   2QLF   2QLJ   3EDR   3H1P   3IBC   3IBF   3R5K   4FDL   4FEA   4HQ0   4HQR   4JB8   4JJ8   4JR1   4JR2   4LSZ   4ZVO   4ZVP   4ZVQ   4ZVR   4ZVS   4ZVT   4ZVU   5IC6  

 GWAS Trait (1)

Gene RIF (98)

PMID Text
26307684 Low expression of CASP7 is associated with non-small cell lung cancer.
26045308 18)F-C-SNAT has significantly increased tumor uptake and significantly increased tumor-to-muscle ratio in a preclinical mouse model of tumor therapy.
25784056 Compared with the TT genotype, the rs10787498GT genotype was associated with an increased cervical cancer risk.
25435190 Centipedegrass extract induces apoptosis through the activation of caspases and the downregulation of PI3K/Akt and MAPK phosphorylation in leukemia cells.
25156550 this report suggests a novel finding that cellular signaling caspase 3/7-PKCdelta-Akt/p38 MAPK is crucial to the repopulation in Panc1 cells after radiotherapy.
24434142 Data show that sangivamycin induced the apoptosis of primary effusion lymphoma (PEL) cells by activating caspase-7 and -9 and suppressed the phosphorylation of Erk1/2 and Akt, thus inhibiting activation of the proteins.
24407236 Phosphorylate caspase-7 bu Src at multiple tyrosine sites enhanced its cellular apoptotic effect.
24040159 Potentially functional polymorphisms in the CASP7 gene contribute to gastric adenocarcinoma susceptibility in an eastern Chinese population.
23979166 Inhibition of activated CASP7 by X-linked inhibitor of apoptosis protein is a potential mechanism by which apoptosis is prevented in those cancer cells deficient in casp3.
23765963 These meta-analysis results demonstrated that CASP-3 and CASP-7 genetic polymorphisms are involved in the pathogenesis of cancer.
More...

AA Sequence

MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKC      1 - 70
IIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACI     71 - 140
LLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPR    141 - 210
YKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDP    211 - 280
HFHEKKQIPCVVSMLTKELYFSQ                                                   281 - 303
//

Text Mined References (177)

PMID Year Title
26307684 2015 MicroRNA-224 is implicated in lung cancer pathogenesis through targeting caspase-3 and caspase-7.
26045308 2015 Preclinical Kinetic Analysis of the Caspase-3/7 PET Tracer 18F-C-SNAT: Quantifying the Changes in Blood Flow and Tumor Retention After Chemotherapy.
25784056 2015 CASP7 variants modify susceptibility to cervical cancer in Chinese women.
25435190 2015 Centipedegrass extract induces apoptosis through the activation of caspases and the downregulation of PI3K/Akt and MAPK phosphorylation in leukemia cells.
25416956 2014 A proteome-scale map of the human interactome network.
25156550 2015 Dying tumor cells stimulate proliferation of living tumor cells via caspase-dependent protein kinase C? activation in pancreatic ductal adenocarcinoma.
24434142 2014 Sangivamycin induces apoptosis by suppressing Erk signaling in primary effusion lymphoma cells.
24407236 2014 Antioxidants decrease the apoptotic effect of 5-Fu in colon cancer by regulating Src-dependent caspase-7 phosphorylation.
24040159 2013 Potentially functional polymorphisms in the CASP7 gene contribute to gastric adenocarcinoma susceptibility in an eastern Chinese population.
23979166 2013 Targeting the XIAP/caspase-7 complex selectively kills caspase-3-deficient malignancies.
More...