Property Summary

NCBI Gene PubMed Count 32
Grant Count 4
R01 Count 4
Funding $229,563.4
PubMed Score 11.86
PubTator Score 142.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.187 0.026
Multiple myeloma 1.856 0.000
astrocytic glioma -1.600 0.009
ependymoma -1.700 0.043
oligodendroglioma -1.600 0.038
psoriasis -1.800 0.000
glioblastoma -1.600 0.001
osteosarcoma -1.193 0.002
medulloblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -1.500 0.001
autosomal dominant Emery-Dreifuss muscul... 1.106 0.002
Amyotrophic Lateral Sclerosis 1.059 0.000
acute quadriplegic myopathy 1.544 0.000
active Crohn's disease 1.112 0.012
Breast cancer 4.100 0.026
adult high grade glioma -1.400 0.001
lung adenocarcinoma -1.200 0.000
nasopharyngeal carcinoma 1.100 0.005
gastric carcinoma 1.100 0.017
ulcerative colitis 1.100 0.000
ovarian cancer -2.000 0.000

Gene RIF (15)

PMID Text
24798879 Nap1 binds to RAD54.
23691099 TAF-Ibeta promotes BZLF1 expression and subsequent lytic infection by affecting chromatin at the BZLF1 promoter
22174317 HIV-1 Rev interacting protein, nucleosome assembly protein 1-like 1 (NAP1L1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with NAP1L1 is decreased by RRE
22134777 NAP1L1 was down-expressed following antiproliferative agent treatment in AuL12-treated cells in comparison with control and with Au(2)Phen-treated ovarian cancer cells.
21333655 Results identified several proteins interacting with NAP1L2, including the ubiquitously expressed members of the nucleosome assembly protein family, NAP1L1 and NAP1L4.
20002496 The biochemical properties of two human NAP1-like proteins, hNAP1L1 and hNAP1L4, were characterized.
19888548 HIV-1 Rev interacting protein, nucleosome assembly protein 1-like 1 (NAP1L1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with NAP1L1 is decreased by RRE
19884766 HIV-1 Rev interacting protein, nucleosome assembly protein 1-like 1 (NAP1L1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with NAP1L1 is decreased by RRE
19884766 HIV-1 Rev interacting protein, nucleosome assembly protein 1-like 1 (NAP1L1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with NAP1L1 is decreased by RRE
19339032 HIV-1 Rev interacting protein, nucleosome assembly protein 1-like 1 (NAP1L1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with NAP1L1 is decreased by RRE
More...

AA Sequence

MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESL      1 - 70
PRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEED     71 - 140
EISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPM    141 - 210
SFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHK    211 - 280
GRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDD    281 - 350
DDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ                                 351 - 391
//

Text Mined References (46)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
24798879 2014 Nap1 stimulates homologous recombination by RAD51 and RAD54 in higher-ordered chromatin containing histone H1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23691099 2013 A role for the nucleosome assembly proteins TAF-I? and NAP1 in the activation of BZLF1 expression and Epstein-Barr virus reactivation.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22134777 2012 2D-DIGE analysis of ovarian cancer cell responses to cytotoxic gold compounds.
More...