Property Summary

NCBI Gene PubMed Count 35
PubMed Score 13.94
PubTator Score 142.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
active Crohn's disease 1.112 1.2e-02
acute quadriplegic myopathy 1.160 2.3e-08
adult high grade glioma -1.400 8.6e-04
Amyotrophic lateral sclerosis 1.003 8.4e-06
astrocytic glioma -1.600 8.8e-03
atypical teratoid / rhabdoid tumor -1.800 2.9e-05
autosomal dominant Emery-Dreifuss muscul... 1.106 1.7e-03
Breast cancer 4.100 2.6e-02
ependymoma -1.700 4.3e-02
gastric carcinoma 1.100 1.7e-02
glioblastoma -1.200 2.3e-04
group 4 medulloblastoma -1.300 1.2e-03
lung adenocarcinoma -1.200 2.3e-07
medulloblastoma, large-cell -1.500 7.8e-04
Multiple myeloma 1.741 1.1e-04
nasopharyngeal carcinoma 1.100 5.3e-03
oligodendroglioma -1.600 3.8e-02
osteosarcoma -1.193 2.1e-03
ovarian cancer -2.000 1.0e-05
psoriasis -1.800 1.1e-04
ulcerative colitis 1.100 3.6e-04
Waldenstrons macroglobulinemia 1.187 2.6e-02

Gene RIF (16)

AA Sequence

MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESL      1 - 70
PRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEED     71 - 140
EISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPM    141 - 210
SFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHK    211 - 280
GRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDD    281 - 350
DDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ                                 351 - 391
//

Text Mined References (49)

PMID Year Title