Property Summary

NCBI Gene PubMed Count 14
Grant Count 4
R01 Count 2
Funding $134,575.5
PubMed Score 29.12
PubTator Score 17.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
psoriasis 1.400 0.000
acute myeloid leukemia 1.200 0.012

Synonym

Accession P55201 B4DEZ6 Q7Z6E0 Q8TCM6 Q9UHI0
Symbols BR140

Gene

PDB

2RS9   4QYD   5FFW   4QYL   2D9E   2X35   2X4W   2X4X   2X4Y   3L42   3MO8   4LC2   4UYE   5C6S   5C7N   5C85   5C87   5C89   5D7X   5DY7   5DYA   5DYC   5E3D   5E3G   5EM3   5EPR   5EPS   5EQ1   5ERC   5ETB   5ETD   5EV9   5EVA   5EWC   5EWD   5EWH   5FFV   5FFY   5FG4   5FG5   5G4R   5G4S  

Gene RIF (7)

PMID Text
25281266 critical insights into the molecular mechanism of ligand binding by the BRPF1 bromodomain
24333487 novel interactions of the BRPF1 bromodomain with multiple acetyllysine residues on the N-terminus of histones show that it preferentially selects for H2AK5ac, H4K12ac, and H3K14ac
24258712 MOZ-TIF2/BRPF1 complex upregulates HOX genes mediated by MOZ-dependent histone acetylation, leading to the development of leukemia.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20400950 Identified is the PWWP domain of bromo and plant homeodomain (PHD) finger-containing protein 1 (BRPF1) as a histone H3 (H3K36me3) binding module; determined is the structure of this domain in complex with an H3K36me3-derived peptide.
19913121 Observational study of gene-disease association. (HuGE Navigator)
18051367 HIV-1 Tat upregulates bromodomain and PHD finger-containing protein 1 (BRPF1) in HEK 293T cells

AA Sequence

MGVDFDVKTFCHNLRATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDNPPPPQQTPLRKHKKKGRQSRP      1 - 70
ANKQSPSPSEVSQSPGREVMSYAQAQRMVEVDLHGRVHRISIFDNLDVVSEDEEAPEEAPENGSNKENTE     71 - 140
TPAATPKSGKHKNKEKRKDSNHHHHHNVSASTTPKLPEVVYRELEQDTPDAPPRPTSYYRYIEKSAEELD    141 - 210
EEVEYDMDEEDYIWLDIMNERRKTEGVSPIPQEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICN    211 - 280
DGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAH    281 - 350
VVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLY    351 - 420
MKMEPVRETGANGTSFSVRKTAYCDIHTPPGSARRLPALSHSEGEEDEDEEEDEGKGWSSEKVKKAKAKS    421 - 490
RIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRLHSYWTLKRQSRNGVPLLRRL    491 - 560
QTHLQSQRNCDQVGRDSEDKNWALKEQLKSWQRLRHDLERARLLVELIRKREKLKRETIKVQQIAMEMQL    561 - 630
TPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLI    631 - 700
VSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGIDFETGMHIPHSLAGDEATHHTEDAAEEER    701 - 770
LVLLENQKHLPVEEQLKLLLERLDEVNASKQSVGRSRRAKMIKKEMTALRRKLAHQRETGRDGPERHGPS    771 - 840
SRGSLTPHPAACDKDGQTDSAAEESSSQETSKGLGPNMSSTPAHEVGRRTSVLFSKKNPKTAGPPKRPGR    841 - 910
PPKNRESQMTPSHGGSPVGPPQLPIMSSLRQRKRGRSPRPSSSSDSDSDKSTEDPPMDLPANGFSGGNQP    911 - 980
VKKSFLVYRNDCSLPRSSSDSESSSSSSSSAASDRTSTTPSKQGRGKPSFSRGTFPEDSSEDTSGTENEA    981 - 1050
YSVGTGRGVGHSMVRKSLGRGAGWLSEDEDSPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPI   1051 - 1120
PVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQI   1121 - 1190
AYHRALQHRSKVQGEQSSETSDSD                                                 1191 - 1214
//

Text Mined References (26)

PMID Year Title
25281266 2014 Structural insights into recognition of acetylated histone ligands by the BRPF1 bromodomain.
24333487 2014 Molecular insights into the recognition of N-terminal histone modifications by the BRPF1 bromodomain.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24258712 2014 Bromodomain-PHD finger protein 1 is critical for leukemogenesis associated with MOZ-TIF2 fusion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21720545 2011 Structural and histone binding ability characterizations of human PWWP domains.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20400950 2010 Molecular basis of histone H3K36me3 recognition by the PWWP domain of Brpf1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...