Property Summary

NCBI Gene PubMed Count 36
PubMed Score 137.21
PubTator Score 69.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
ovarian cancer -1.400 4.2e-08
aldosterone-producing adenoma -1.010 1.5e-02
astrocytic glioma -1.600 5.7e-03
atypical teratoid / rhabdoid tumor 2.000 4.2e-04
ependymoma -1.700 6.5e-03
glioblastoma 1.600 1.7e-03
group 3 medulloblastoma 1.500 8.8e-03
lung cancer 1.600 3.7e-02
medulloblastoma, large-cell 2.100 3.3e-04
non primary Sjogren syndrome sicca -1.100 2.4e-02
oligodendroglioma -1.500 4.6e-03
osteosarcoma 1.661 1.4e-04
Pick disease 1.800 1.1e-05
primitive neuroectodermal tumor 1.700 7.9e-03
psoriasis -1.200 9.4e-11
Rheumatoid arthritis 1.800 7.6e-04

Gene RIF (19)

AA Sequence

MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVYCDGHGCSVAVHQACYGIVQVPTGPWFCRK      1 - 70
CESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANVSTMEPIVLQSVPHDRYNKTCYIC     71 - 140
DEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSNR    141 - 210
SYDQSLSDSSSHSQDKHHEKEKKKYKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTYTSTSNNSISGSLK    211 - 280
RLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQ    281 - 350
GSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGL    351 - 420
PSTSAVTSQPKSFENSPGDLGNSSLPTAGYKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENV    421 - 490
SHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQYRHDGACPTTTFSEL    491 - 560
LNAIHNGIYNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTL    561 - 630
SGSSLSQAPSHMYGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRYDQ    631 - 700
PGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKER    701 - 770
LQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQS    771 - 840
TSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAIN    841 - 910
GIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNS    911 - 980
QQLTPEQHQAFLYQLMQHHHQQHHQPELQQLQIPGPTQIPINNLLAGTQAPPLHTATTNPFLTIHGDNAS    981 - 1050
QKVARLSDKTGPVAQEKS                                                       1051 - 1068
//

Text Mined References (45)

PMID Year Title