Property Summary

NCBI Gene PubMed Count 33
Grant Count 23
R01 Count 18
Funding $1,533,468.37
PubMed Score 130.20
PubTator Score 69.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Rheumatoid Arthritis 1.800 0.001
astrocytic glioma -1.600 0.006
ependymoma -1.700 0.007
oligodendroglioma -1.500 0.005
osteosarcoma 2.708 0.000
sonic hedgehog group medulloblastoma 2.000 0.000
atypical teratoid / rhabdoid tumor 2.000 0.000
glioblastoma 1.600 0.002
medulloblastoma, large-cell 2.200 0.000
primitive neuroectodermal tumor 1.700 0.008
lung cancer 1.600 0.037
non primary Sjogren syndrome sicca -1.100 0.024
aldosterone-producing adenoma -1.010 0.015
psoriasis -1.200 0.000
Pick disease 1.800 0.000
ovarian cancer -1.400 0.000

Gene RIF (17)

PMID Text
26439302 The PZP domain of AF10 senses unmodified H3K27 to regulate DOT1L-mediated methylation of H3K79.
25464900 Results provide evidence that transformation driven by MLL fusions as well as the recurrent AML-associated NUP98-NSD1 fusion oncogene is critically dependent on the ability of AF10 to stimulate DOT1L activity.
24755950 we report that variants at the MLLT10 locus are unlikely to alter risk of glioma, and they have no prognostic value among patients with high-grade tumors (glioblastoma).
23673860 In pediatric T-acute lymphoblastic leukemia, we have identified 2 RNA processing genes, that is, HNRNPH1/5q35 and DDX3X/Xp11.3 as new MLLT10 fusion partners.
23670296 detection of PICALM-MLLT10 fusion transcript occurs in 7% of children with T-lineage ALL and is not associated with a poorer outcome for patients treated with contemporary, intensive chemotherapy
22064352 results strongly indicate that the differential regulation of these three genes is not due to the break point effect but as a consequence of the CALM/AF10 fusion gene expression, though the mechanism of regulation is not well understood
21804547 a new susceptibility locus for meningioma at 10p12.31 (MLLT10, rs11012732, odds ratio = 1.46, P(combined) = 1.88 x 10(-14)) was identified.
21706055 In leukemia cells, full-length CALM-AF10 localized to the nucleus with no consistent effect on growth factor endocyctosis, and suppressed histone H3 lysine 79 methylation regardless of the presence of clathrin
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVYCDGHGCSVAVHQACYGIVQVPTGPWFCRK      1 - 70
CESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANVSTMEPIVLQSVPHDRYNKTCYIC     71 - 140
DEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSNR    141 - 210
SYDQSLSDSSSHSQDKHHEKEKKKYKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTYTSTSNNSISGSLK    211 - 280
RLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQ    281 - 350
GSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGL    351 - 420
PSTSAVTSQPKSFENSPGDLGNSSLPTAGYKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENV    421 - 490
SHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQYRHDGACPTTTFSEL    491 - 560
LNAIHNGIYNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTL    561 - 630
SGSSLSQAPSHMYGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRYDQ    631 - 700
PGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKER    701 - 770
LQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQS    771 - 840
TSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAIN    841 - 910
GIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNS    911 - 980
QQLTPEQHQAFLYQLMQHHHQQHHQPELQQLQIPGPTQIPINNLLAGTQAPPLHTATTNPFLTIHGDNAS    981 - 1050
QKVARLSDKTGPVAQEKS                                                       1051 - 1068
//

Text Mined References (42)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26439302 2015 The PZP Domain of AF10 Senses Unmodified H3K27 to Regulate DOT1L-Mediated Methylation of H3K79.
25464900 2014 AF10 regulates progressive H3K79 methylation and HOX gene expression in diverse AML subtypes.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24755950 2015 Brain tumor risk according to germ-line variation in the MLLT10 locus.
23673860 2013 New MLLT10 gene recombinations in pediatric T-acute lymphoblastic leukemia.
23670296 2013 Detection of PICALM-MLLT10 (CALM-AF10) and outcome in children with T-lineage acute lymphoblastic leukemia.
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...