Property Summary

NCBI Gene PubMed Count 70
Grant Count 61
R01 Count 43
Funding $3,081,555.7
PubMed Score 136.73
PubTator Score 80.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
astrocytic glioma -1.700 0.010
posterior fossa group A ependymoma -2.300 0.000
oligodendroglioma -1.300 0.026
osteosarcoma -1.351 0.010
glioblastoma -2.300 0.000
group 4 medulloblastoma 2.000 0.000
atypical teratoid / rhabdoid tumor -1.800 0.004
hereditary spastic paraplegia -1.016 0.042
primary pancreatic ductal adenocarcinoma 1.266 0.006
adult high grade glioma -1.900 0.001
pilocytic astrocytoma -2.100 0.000
spina bifida -1.381 0.039
ovarian cancer -1.700 0.000
pituitary cancer -1.300 0.000
pancreatic cancer 1.300 0.008

Synonym

Accession P55196 O75087 O75088 O75089 Q59FP0 Q5TIG6 Q5TIG7 Q9NSN7 Q9NU92
Symbols AF6
MLLT4
MLL-AF6

Gene

PDB

2AIN   5A6C   1T2M   1XZ9   2EXG  

Gene RIF (26)

PMID Text
26013125 In pancreatic cancer cells, AF6 is expressed at reduced levels, causing Dvl2 to be upregulated and available to bind and enhance FOXE1-induced trans-activation of Snail, which promotes proliferation and metastasis.
25879875 AF-6/afadin could be a useful selection marker for fertility-sparing therapy for patients with atypical hyperplasia or grade 1 endometrioid adenocarcinoma with no myometrial invasion.
25631074 Cellular biotinylated myeloid/lymphoid or mixed-lineage leukemia; translocated to, 4 (MLLT4, Afadin) protein is incorporated into HIV-1 Gag virus-like particles
24695851 MLL-AF6 oncoprotein potentiates the activity of the RAS pathway through retention of AF6 within the nucleus.
24373847 The expression levels of CFTR and AF-6/afadin are significantly downregulated in human colon cancer tissues.
23885123 JAM-A regulates epithelial permeability via association with ZO-2, afadin, and PDZ-GEF1 to activate Rap2c and control contraction of the apical cytoskeleton.
23393160 AF-6 is a positive modulator of the PINK1/parkin pathway and is deficient in Parkinson's disease.
21880730 the Necl-5-nectin, nectin-nectin, and nectin-afadin interactions cooperatively increase the clustering of the nectin-afadin complex at the cell-cell contact sites, promoting the formation of the nectin-based cell-cell adhesion.
21732359 Results demonstrate a role for afadin in the regulation of vascular barrier function via coordination of adherens junction-tight junction and p120-catenin-ZO-1 interactions.
21478912 AF6/afadin is a marker of poor outcome in breast cancer, and its loss induces cell migration, invasiveness and tumor growth
More...

AA Sequence

MSAGGRDEERRKLADIIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQD      1 - 70
VIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNENDAIPPKKA     71 - 140
QSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENSRLAAEVYKDMPETS    141 - 210
FTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAE    211 - 280
ALEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPPDH    281 - 350
IPKKTKKHLEGKTPKGKERADGSGYGSTLPPEKLPYLVELSPGRRNHFAYYNYHTYEDGSDSRDKPKLYR    351 - 420
LQLSVTEVGTEKLDDNSIQLFGPGIQPHHCDLTNMDGVVTVTPRSMDAETYVEGQRISETTMLQSGMKVQ    421 - 490
FGASHVFKFVDPSQDHALAKRSVDGGLMVKGPRHKPGIVQETTFDLGGDIHSGTALPTSKSTTRLDSDRV    491 - 560
SSASSTAERGMVKPMIRVEQQPDYRRQESRTQDASGPELILPASIEFRESSEDSFLSAIINYTNSSTVHF    561 - 630
KLSPTYVLYMACRYVLSNQYRPDISPTERTHKVIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLN    631 - 700
FIKQDRDLSRITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLDDPEENSLQRPKIDDVLHTLTGAM    701 - 770
SLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHYWGAIIRQQLGHIEAWAEKQGLELAAD    771 - 840
CHLSRIVQATTLLTMDKYAPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPTDLIENVVTVAENTA    841 - 910
DELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVRNIPNGLQEFLDPLCQRGFCRLIPHTRSPGTWTIY    911 - 980
FEGADYESHLLRENTELAQPLRKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDG    981 - 1050
RLAAGDQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIYHGLATLLNQPSPMMQRISDRRGSG   1051 - 1120
KPRPKSEGFELYNNSTQNGSPESPQLPWAEYSEPKKLPGDDRLMKNRADHRSSPNVANQPPSPGGKSAYA   1121 - 1190
SGTTAKITSVSTGNLCTEEQTPPPRPEAYPIPTQTYTREYFTFPASKSQDRMAPPQNQWPNYEEKPHMHT   1191 - 1260
DSNHSSIAIQRVTRSQEELREDKAYQLERHRIEAAMDRKSDSDMWINQSSSLDSSTSSQEHLNHSSKSVT   1261 - 1330
PASTLTKSGPGRWKTPAAIPATPVAVSQPIRTDLPPPPPPPPVHYAGDFDGMSMDLPLPPPPSANQIGLP   1331 - 1400
SAQVAAAERRKREEHQRWYEKEKARLEEERERKRREQERKLGQMRTQSLNPAPFSPLTAQQMKPEKPSTL   1401 - 1470
QRPQETVIRELQPQQQPRTIERRDLQYITVSKEELSSGDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEI   1471 - 1540
QELQSKPDRSAEESDRLRKLMLEWQFQKRLQESKQKDEDDEEEEDDDVDTMLIMQRLEAERRARLQDEER   1541 - 1610
RRQQQLEEMRKREAEDRARQEEERRRQEEERTKRDAEEKRRQEEGYYSRLEAERRRQHDEAARRLLEPEA   1611 - 1680
PGLCRPPLPRDYEPPSPSPAPGAPPPPPQRNASYLKTQVLSPDSLFTAKFVAYNEEEEEEDCSLAGPNSY   1681 - 1750
PGSTGAAVGAHDACRDAKEKRSKSQDADSPGSSGAPENLTFKERQRLFSQGQDVSNKVKASRKLTELENE   1751 - 1820
LNTK                                                                     1821 - 1824
//

Text Mined References (81)

PMID Year Title
26013125 2015 Loss of polarity protein AF6 promotes pancreatic cancer metastasis by inducing Snail expression.
25879875 2015 Loss of AF-6/afadin induces cell invasion, suppresses the formation of glandular structures and might be a predictive marker of resistance to chemotherapy in endometrial cancer.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24695851 2014 MLL-AF6 fusion oncogene sequesters AF6 into the nucleus to trigger RAS activation in myeloid leukemia.
24373847 2014 Disrupted interaction between CFTR and AF-6/afadin aggravates malignant phenotypes of colon cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23885123 2013 JAM-A associates with ZO-2, afadin, and PDZ-GEF1 to activate Rap2c and regulate epithelial barrier function.
23750010 2013 Drebrin preserves endothelial integrity by stabilizing nectin at adherens junctions.
23393160 2013 AF-6 is a positive modulator of the PINK1/parkin pathway and is deficient in Parkinson's disease.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
More...