Property Summary

NCBI Gene PubMed Count 11
PubMed Score 11.18
PubTator Score 6.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma -1.173 7.3e-03
adult high grade glioma 1.100 2.1e-02
Astrocytoma, Pilocytic 1.600 6.7e-07
cutaneous lupus erythematosus 1.900 1.1e-03
diabetes mellitus -1.200 4.7e-02
glioblastoma 1.100 1.3e-02
group 3 medulloblastoma -1.100 1.3e-02
head and neck cancer and chronic obstruc... 1.100 7.7e-03
interstitial cystitis 2.100 1.3e-03
intraductal papillary-mucinous carcinoma... -1.300 1.7e-02
invasive ductal carcinoma 1.214 3.4e-04
lung cancer -1.100 1.2e-02
lung carcinoma -3.000 1.5e-28
medulloblastoma, large-cell -1.400 3.5e-04
non-small cell lung cancer -1.340 2.5e-13
osteosarcoma -1.902 1.2e-03
ovarian cancer -2.400 1.7e-07
primary Sjogren syndrome 2.300 8.6e-05
spina bifida 1.010 3.0e-02
subependymal giant cell astrocytoma 2.139 4.4e-03
ulcerative colitis 1.900 2.4e-04

Gene RIF (3)

AA Sequence

MSLTSAYQHKLAEKLTILNDRGQGVLIRMYNIKKTCSDPKSKPPFLLEKSMEPSLKYINKKFPNIDVRNS      1 - 70
TQHLGPVHREKAEIIRFLTNYYQSFVDVMEFRDHVYELLNTIDACQCHFDINLNFDFTRSYLDLIVTYTS     71 - 140
VILLLSRIEDRRILIGMYNCAHEMLHGHGDPSFARLGQMVLEYDHPLKKLTEEFGPHTKAVSGALLSLHF    141 - 210
LFVRRNQGAEQWRSAQLLSLISNPPAMINPANSDTMACEYLSVEVMERWIIIGFLLCHGCLNSNSQCQKL    211 - 280
WKLCLQGSLYITLIREDVLQVHKVTEDLFSSLKGYGKRVADIKESKEHVIANSGQFHCQRRQFLRMAVKE    281 - 350
LETVLADEPGLLGPKALFAFMALSFIRDEVTWLVRHTENVTKTKTPEDYADSSIAELLFLLEGIRSLVRR    351 - 420
HIKVIQQYHLQYLARFDALVLSDIIQNLSVCPEEESIIMSSFVSILSSLNLKQVDNGEKFEFSGLRLDWF    421 - 490
RLQAYTSVAKAPLHLHENPDLAKVMNLIVFHSRMLDSVEKLLVETSDLSTFCFHLRIFEKMFAMTLEESA    491 - 560
MLRYAIAFPLICAHFVHCTHEMCPEEYPHLKNHGLHHCNSFLEELAKQTSNCVLEICAEQRNLSEQLLPK    561 - 630
HCATTISKAKNKKTRKQRQTPRKGEPERDKPGAESHRKNRSIVTNMDKLHLNLTELALTMNHVYSFSVFE    631 - 700
HTIFPSEYLSSHLEARLNRAIVWLAGYNATTQEIVRPSELLAGVKAYIGFIQSLAQFLGADASRVIRNAL    701 - 770
LQQTQPLDSCGEQTITTLYTNWYLESLLRQASSGTIILSPAMQAFVSLPREGEQNFSAEEFSDISEMRAL    771 - 840
AELLGPYGMKFLSENLMWHVTSQIVELKKLVVENMDILVQIRSNFSKPDLMASLLPQLTGAENVLKRMTI    841 - 910
IGVILSFRAMAQEGLREVFSSHCPFLMGPIECLKEFVTPDTDIKVTLSIFELASAAGVGCDIDPALVAAI    911 - 980
ANLKADTSSPEEEYKVACLLLIFLAVSLPLLATDPSSFYSIEKDGYNNNIHCLTKAIIQVSAALFTLYNK    981 - 1050
NIETHLKEFLVVASVSLLQLGQETDKLKTRNRESISLLMRLVVEESSFLTLDMLESCFPYVLLRNAYREV   1051 - 1120
SRAFHLN                                                                  1121 - 1127
//

Text Mined References (17)

PMID Year Title