Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.75
PubTator Score 6.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
lung carcinoma 2844 1.45790868162898E-28
non-small cell lung cancer 2798 2.26360605001997E-14
ovarian cancer 8492 1.6786147609541E-7
pilocytic astrocytoma 3086 1.67965692833069E-6
lung cancer 4473 5.51904851905622E-5
primary Sjogren syndrome 789 8.57814866385296E-5
ulcerative colitis 2087 2.37994662743522E-4
invasive ductal carcinoma 2950 3.44043055352367E-4
medulloblastoma, large-cell 6234 3.54143768759277E-4
cutaneous lupus erythematosus 1056 0.00110583474149023
osteosarcoma 7933 0.00122209891978358
interstitial cystitis 2299 0.00129986678362437
adrenocortical carcinoma 1427 0.00734971111239537
head and neck cancer and chronic obstructive pulmonary disease 237 0.00773062781707795
glioblastoma 5572 0.0125208144329488
group 3 medulloblastoma 2254 0.0134094420814629
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.016989062169363
subependymal giant cell astrocytoma 2287 0.0184566460871754
adult high grade glioma 2148 0.0208702917777014
spina bifida 1064 0.0303030583461835
diabetes mellitus 1663 0.0466036414376446
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Hypochromic anemia 6 3.767 1.9

Expression

Synonym

Accession P55160 B4DUT5 Q52LW0
Symbols HEM1

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (2)

PMID Text
17696648 the Hem-1/Nap1 component of the Scar/WAVE complex localizes to propagating waves that appear to organize the leading edge of a motile neutrophil
16417406 versatile Hem-1-containing complexes coordinate diverse regulatory signals at the leading edge of polarized neutrophils, including but not confined to those involving Verprolin-homologous protein-dependent actin polymerization

AA Sequence

MSLTSAYQHKLAEKLTILNDRGQGVLIRMYNIKKTCSDPKSKPPFLLEKSMEPSLKYINKKFPNIDVRNS      1 - 70
TQHLGPVHREKAEIIRFLTNYYQSFVDVMEFRDHVYELLNTIDACQCHFDINLNFDFTRSYLDLIVTYTS     71 - 140
VILLLSRIEDRRILIGMYNCAHEMLHGHGDPSFARLGQMVLEYDHPLKKLTEEFGPHTKAVSGALLSLHF    141 - 210
LFVRRNQGAEQWRSAQLLSLISNPPAMINPANSDTMACEYLSVEVMERWIIIGFLLCHGCLNSNSQCQKL    211 - 280
WKLCLQGSLYITLIREDVLQVHKVTEDLFSSLKGYGKRVADIKESKEHVIANSGQFHCQRRQFLRMAVKE    281 - 350
LETVLADEPGLLGPKALFAFMALSFIRDEVTWLVRHTENVTKTKTPEDYADSSIAELLFLLEGIRSLVRR    351 - 420
HIKVIQQYHLQYLARFDALVLSDIIQNLSVCPEEESIIMSSFVSILSSLNLKQVDNGEKFEFSGLRLDWF    421 - 490
RLQAYTSVAKAPLHLHENPDLAKVMNLIVFHSRMLDSVEKLLVETSDLSTFCFHLRIFEKMFAMTLEESA    491 - 560
MLRYAIAFPLICAHFVHCTHEMCPEEYPHLKNHGLHHCNSFLEELAKQTSNCVLEICAEQRNLSEQLLPK    561 - 630
HCATTISKAKNKKTRKQRQTPRKGEPERDKPGAESHRKNRSIVTNMDKLHLNLTELALTMNHVYSFSVFE    631 - 700
HTIFPSEYLSSHLEARLNRAIVWLAGYNATTQEIVRPSELLAGVKAYIGFIQSLAQFLGADASRVIRNAL    701 - 770
LQQTQPLDSCGEQTITTLYTNWYLESLLRQASSGTIILSPAMQAFVSLPREGEQNFSAEEFSDISEMRAL    771 - 840
AELLGPYGMKFLSENLMWHVTSQIVELKKLVVENMDILVQIRSNFSKPDLMASLLPQLTGAENVLKRMTI    841 - 910
IGVILSFRAMAQEGLREVFSSHCPFLMGPIECLKEFVTPDTDIKVTLSIFELASAAGVGCDIDPALVAAI    911 - 980
ANLKADTSSPEEEYKVACLLLIFLAVSLPLLATDPSSFYSIEKDGYNNNIHCLTKAIIQVSAALFTLYNK    981 - 1050
NIETHLKEFLVVASVSLLQLGQETDKLKTRNRESISLLMRLVVEESSFLTLDMLESCFPYVLLRNAYREV   1051 - 1120
SRAFHLN                                                                  1121 - 1127
//

Text Mined References (16)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
17875758 2007 ATM, CTLA4, MNDA, and HEM1 in high versus low CD38 expressing B-cell chronic lymphocytic leukemia.
17696648 2007 An actin-based wave generator organizes cell motility.
16541075 2006 The finished DNA sequence of human chromosome 12.
16417406 2006 Hem-1 complexes are essential for Rac activation, actin polymerization, and myosin regulation during neutrophil chemotaxis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...