Property Summary

Ligand Count 151
NCBI Gene PubMed Count 139
PubMed Score 331.14
PubTator Score 232.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma 1.100 2.1e-03
ependymoma 2.000 9.7e-08
glioblastoma 1.100 2.6e-02
pancreatic ductal adenocarcinoma liver m... -2.481 2.0e-02

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (135)

AA Sequence

MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGKLQDSVGYRISSNVDVALLWR      1 - 70
NPDGDDDQLIQITMKDVNVENVNQQRGEKSIFKGKSPSKIMGKENLEALQRPTLLHLIHGKVKEFYSYQN     71 - 140
EAVAIENIKRGLASLFQTQLSSGTTNEVDISGNCKVTYQAHQDKVIKIKALDSCKIARSGFTTPNQVLGV    141 - 210
SSKATSVTTYKIEDSFVIAVLAEETHNFGLNFLQTIKGKIVSKQKLELKTTEAGPRLMSGKQAAAIIKAV    211 - 280
DSKYTAIPIVGQVFQSHCKGCPSLSELWRSTRKYLQPDNLSKAEAVRNFLAFIQHLRTAKKEEILQILKM    281 - 350
ENKEVLPQLVDAVTSAQTSDSLEAILDFLDFKSDSSIILQERFLYACGFASHPNEELLRALISKFKGSIG    351 - 420
SSDIRETVMIITGTLVRKLCQNEGCKLKAVVEAKKLILGGLEKAEKKEDTRMYLLALKNALLPEGIPSLL    421 - 490
KYAEAGEGPISHLATTALQRYDLPFITDEVKKTLNRIYHQNRKVHEKTVRTAAAAIILNNNPSYMDVKNI    491 - 560
LLSIGELPQEMNKYMLAIVQDILRFEMPASKIVRRVLKEMVAHNYDRFSRSGSSSAYTGYIERSPRSAST    561 - 630
YSLDILYSGSGILRRSNLNIFQYIGKAGLHGSQVVIEAQGLEALIAATPDEGEENLDSYAGMSAILFDVQ    631 - 700
LRPVTFFNGYSDLMSKMLSASGDPISVVKGLILLIDHSQELQLQSGLKANIEVQGGLAIDISGAMEFSLW    701 - 770
YRESKTRVKNRVTVVITTDITVDSSFVKAGLETSTETEAGLEFISTVQFSQYPFLVCMQMDKDEAPFRQF    771 - 840
EKKYERLSTGRGYVSQKRKESVLAGCEFPLHQENSEMCKVVFAPQPDSTSSGWF                    841 - 894
//

Text Mined References (144)

PMID Year Title