Property Summary

NCBI Gene PubMed Count 27
Grant Count 33
R01 Count 10
Funding $3,626,206.03
PubMed Score 114.89
PubTator Score 149.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (10)

PMID Text
26720341 the role of two short sequence motifs within the carboxy-(C) terminal domain of MANF in its neuroprotective activity, was studied.
26429332 the selective expression of MANF in splenocytes may be involved in plasma cell differentiation and immune regulation.
25543119 MANF is a protein that interacts with RTN1-C
23956175 We demonstrate that Armet and Creld2 are genotype-specific ER stress response proteins with substrate specificities, and that aggregation of mutant matrilin-3 is a key disease trigger in MED that could be exploited as a potential therapeutic target
23255601 MANF binding to the plasma membrane also required the RTDL sequence and was inhibited with a peptide known to interact with KDELRs, suggesting MANF binds KDELRs at the surface.
21047780 MANF and C-MANF protect neurons intracellularly as efficiently as Ku70.
20685313 Pretreatment with adeno-associated-virus vector containing human MANF reduces the volume of cerebral infarction and facilitates behavioral recovery in experimental stroke rats.
19258449 structures of MANF and CDNF were solved; structure explains why MANF and CDNF are bifunctional; neurotrophic activity may reside in the N-terminal domain and ER stress response in the C-terminal domain
18718866 The widespread expression of MANF together with its evolutionary conserved nature and regulation by brain insults suggest that it has important functions both under normal and pathological conditions in many tissue types.
18561914 Armet is a novel secreted mediator of the adaptive pathway of unfolded protein response.

AA Sequence

MRRMWATQGLAVALALSVLPGSRALRPGDCEVCISYLGRFYQDLKDRDVTFSPATIENELIKFCREARGK      1 - 70
ENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICEKLKKKDSQICELKYDKQIDLSTVDLKKLRVKEL     71 - 140
KKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASARTDL                                141 - 182
//

Text Mined References (32)

PMID Year Title
26720341 2015 Role of two sequence motifs of mesencephalic astrocyte-derived neurotrophic factor in its survival-promoting activity.
26429332 2015 ER stress-inducible protein MANF selectively expresses in human spleen.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25543119 2015 Identification of MANF as a protein interacting with RTN1-C.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23956175 2013 Armet/Manf and Creld2 are components of a specialized ER stress response provoked by inappropriate formation of disulphide bonds: implications for genetic skeletal diseases.
23255601 2013 Mesencephalic astrocyte-derived neurotrophic factor (MANF) secretion and cell surface binding are modulated by KDEL receptors.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
More...