Property Summary

NCBI Gene PubMed Count 28
PubMed Score 128.59
PubTator Score 149.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease 1.198 7.1e-03
lung cancer 1.500 2.4e-03
non primary Sjogren syndrome sicca 1.400 1.9e-02
ovarian cancer 1.500 2.5e-03
pancreatic cancer 1.300 6.7e-03
pancreatic carcinoma 1.300 6.7e-03
pancreatic ductal adenocarcinoma liver m... -1.146 1.3e-02
tuberculosis and treatment for 3 months -1.300 1.5e-05
ulcerative colitis 1.300 1.3e-08

Gene RIF (11)

AA Sequence

MRRMWATQGLAVALALSVLPGSRALRPGDCEVCISYLGRFYQDLKDRDVTFSPATIENELIKFCREARGK      1 - 70
ENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICEKLKKKDSQICELKYDKQIDLSTVDLKKLRVKEL     71 - 140
KKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASARTDL                                141 - 182
//

Text Mined References (33)

PMID Year Title