Property Summary

NCBI Gene PubMed Count 32
PubMed Score 12.31
PubTator Score 9.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
psoriasis 6694 1.0e-07
osteosarcoma 7950 1.3e-06
pancreatic ductal adenocarcinoma liver metastasis 1962 3.8e-02
Disease Target Count Z-score Confidence
Gout 106 3.187 1.6
Disease Target Count Z-score Confidence
Gastric diffuse adenocarcinoma 1 3.365 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.297 1.3e-06
pancreatic ductal adenocarcinoma liver m... -1.057 3.8e-02
psoriasis -1.100 1.0e-07

Protein-protein Interaction (1)

Gene RIF (22)

AA Sequence

MTSSLLLAFLLLAPTTVATPRAGGQCPACGGPTLELESQRELLLDLAKRSILDKLHLTQRPTLNRPVSRA      1 - 70
ALRTALQHLHGVPQGALLEDNREQECEIISFAETGLSTINQTRLDFHFSSDRTAGDREVQQASLMFFVQL     71 - 140
PSNTTWTLKVRVLVLGPHNTNLTLATQYLLEVDASGWHQLPLGPEAQAACSQGHLTLELVLEGQVAQSSV    141 - 210
ILGGAAHRPFVAARVRVGGKHQIHRRGIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQC    211 - 280
PLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACG    281 - 350
CS                                                                        351 - 352
//

Text Mined References (33)

PMID Year Title