Property Summary

NCBI Gene PubMed Count 31
PubMed Score 10.86
PubTator Score 9.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.297 0.000
pancreatic ductal adenocarcinoma liver m... -1.057 0.038
psoriasis -1.100 0.000

Synonym

Accession P55103 A1L3Y2
Symbols IHBC

Gene

PANTHER Protein Class (2)

Gene RIF (21)

PMID Text
25062451 Activin A, B, and AB have similar effects on steroidogenesis in human granulosa cells; in contrast, activin AC is not biologically active and does not act as a competitive antagonist.
24599287 Serum inhibin levels correlate with clinical characteristics and mortality in epithelial ovarian cancer patients.
23580013 The inhibin-betaC subunit is down-regulated, while inhibin-betaE is up-regulated by interferon-beta1a in Ishikawa carcinoma cell line.
23284751 Single Nucleotide Polymorphisms in INHBC gene is associated with brain metastasis in non-small-cell lung cancer
23180294 Activin-beta(C) is a regulator of activin-A. Activin-beta(C) is able to abolish cachexia and modulate reproductive tumour development in inhibin alpha-subunit knockout mice (alpha-KO) mice.
21529351 Data show that inhibin A levels were significantly lower in the PCOS group compared to the control group, and inhibin B levels were comparable in the two groups.
21117833 inhibin-betaC in normal and pathological placental tissue was demonstrated, although no differences in staining intensity could be observed. Functional role of novel inhibin-betaC subunit in normal and pathological human placenta is still quite unclear.
21092084 differential expression pattern of the betaC- and betaE-subunits in normal human endometrial tissue suggests that they function in endometrial maturation and blastocyst implantation.
21063444 Observational study of gene-disease association. (HuGE Navigator)
20952735 the novel inhibin/activin-betaC subunit is expressed in human endometrioid adenocarcinomas and in the human endometrial carcinoma cell line HEC-1a
More...

AA Sequence

MTSSLLLAFLLLAPTTVATPRAGGQCPACGGPTLELESQRELLLDLAKRSILDKLHLTQRPTLNRPVSRA      1 - 70
ALRTALQHLHGVPQGALLEDNREQECEIISFAETGLSTINQTRLDFHFSSDRTAGDREVQQASLMFFVQL     71 - 140
PSNTTWTLKVRVLVLGPHNTNLTLATQYLLEVDASGWHQLPLGPEAQAACSQGHLTLELVLEGQVAQSSV    141 - 210
ILGGAAHRPFVAARVRVGGKHQIHRRGIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQC    211 - 280
PLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACG    281 - 350
CS                                                                        351 - 352
//

Text Mined References (32)

PMID Year Title
25062451 2014 Effects of recombinant activins on steroidogenesis in human granulosa-lutein cells.
24599287 2014 Serum inhibin A and inhibin B levels in epithelial ovarian cancer patients.
23580013 2013 The inhibin-?C subunit is down-regulated, while inhibin-?E is up-regulated by interferon-?1a in Ishikawa carcinoma cell line.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23284751 2012 SNPs in the TGF-? signaling pathway are associated with increased risk of brain metastasis in patients with non-small-cell lung cancer.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
23180294 2013 Activin-?(c) reduces reproductive tumour progression and abolishes cancer-associated cachexia in inhibin-deficient mice.
21529351 2011 Inhibin secretion in women with the polycystic ovary syndrome before and after treatment with progesterone.
21117833 2011 Inhibin-betaC subunit expression in normal and pathological human placental tissues.
21092084 2010 Evidence of inhibin/activin subunit betaC and betaE synthesis in normal human endometrial tissue.
More...