Property Summary

NCBI Gene PubMed Count 75
Grant Count 310
R01 Count 121
Funding $25,871,524.87
PubMed Score 595.18
PubTator Score 280.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma -1.200 0.000
atypical teratoid / rhabdoid tumor -1.500 0.001
glioblastoma -1.400 0.000
medulloblastoma, large-cell -1.800 0.000
pediatric high grade glioma -1.200 0.000
group 4 medulloblastoma -1.300 0.002
pilocytic astrocytoma -1.200 0.000

Synonym

Accession P55089 Q6FG64
Symbols UI
UROC

Gene

UCN

PANTHER Protein Class (2)

PDB

2RMF   3N96  

Gene RIF (50)

PMID Text
26138318 Findings identify Ucn as a potential mediator that inhibits TGFbeta1 oncogenic signaling in breast neoplasm.
25951715 In women with adnexal endometrioma versus teratoma, the medians were 105.31 pg/mL versus 120.84 pg/mL for urocortin, 7.16 pg/mL versus 9.13 pg/mL for leptin and 584.33 pg/mL versus 657.82 pg/mL for ghrelin (p > 0.05), respectively.
25462164 Ucn1 prevents the development of atherosclerosis by suppressing EC inflammatory response and proliferation, macrophage foam cell formation, and VSMC migration and proliferation
25339828 Production of CRF and UCN1 in human dendritic cells is strongly augmented by commensal intestinal bacteria.
25240771 These data suggest that UVB-stimulated Ucn1 contributes to TRP1 production via the transcription of both Nurr-1 and Nur77. Ucn1, produced in melanoma cells, acts on melanoma cells themselves in an autocrine manner.
25239507 UCN I is secreted from human glioblastoma cells by exocytosis through constitutive secretory granules.
25172671 down-regulated expression in the placenta and maternal serum during intrahepatic cholestasis of pregnancy may impair the blood flow regulation of the utero-placental-fetal unit and contribute to fetal distress
24954177 Cardioplegic arrest failed to induce cardiac myocyte overexpression of urocortin in diabetic hearts.
24290358 A detailed conformational model for the CRF1R-Ucn1 complex based on the many ligand-receptor interactions determined was here and eventually revealed unique features of peptide ligand binding to class B GPCRs.
24012814 all neonates expressed UCN1 in the Edinger-Westphal nucleus independent of the degree of neuropathological injury.
More...

AA Sequence

MRQAGRAALLAALLLLVQLCPGSSQRSPEAAGVQDPSLRWSPGARNQGGGARALLLLLAERFPRRAGPGR      1 - 70
LGLGTAGERPRRDNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSVGK                     71 - 124
//

Text Mined References (78)

PMID Year Title
26138318 2015 Urocortin attenuates TGF?1-induced Snail1 and slug expressions: inhibitory role of Smad7 in Smad2/3 signaling in breast cancer cells.
25951715 2015 Novel markers in the diagnostics of endometriomas: Urocortin, ghrelin, and leptin or leukocytes, fibrinogen, and CA-125?
25541373 2015 Urocortin--from Parkinson's disease to the skeleton.
25462164 2014 Vasoprotective effects of urocortin 1 against atherosclerosis in vitro and in vivo.
25339828 2014 Production of corticotropin-releasing factor and urocortin from human monocyte-derived dendritic cells is stimulated by commensal bacteria in intestine.
25240771 2014 Ultraviolet B radiation-stimulated urocortin 1 is involved in tyrosinase-related protein 1 production in human melanoma HMV-II cells.
25239507 2015 Secretion of urocortin I by human glioblastoma cell lines, possibly via the constitutive pathway.
25172671 2014 Expression of urocortin and corticotrophin-releasing hormone receptor-2 in patients with intrahepatic cholestasis of pregnancy.
24954177 2014 Diabetic hearts have lower basal urocortin levels that fail to increase after cardioplegic arrest: association with increased apoptosis and postsurgical cardiac dysfunction.
24290358 2013 Genetically encoded chemical probes in cells reveal the binding path of urocortin-I to CRF class B GPCR.
More...