Property Summary

NCBI Gene PubMed Count 77
PubMed Score 622.02
PubTator Score 280.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic -1.200 1.2e-04
atypical teratoid / rhabdoid tumor -1.500 6.7e-04
ependymoma -1.200 5.3e-06
glioblastoma -1.400 2.6e-04
group 4 medulloblastoma -1.300 2.0e-03
medulloblastoma, large-cell -1.800 6.0e-06
pediatric high grade glioma -1.200 3.8e-04

Gene RIF (52)

AA Sequence

MRQAGRAALLAALLLLVQLCPGSSQRSPEAAGVQDPSLRWSPGARNQGGGARALLLLLAERFPRRAGPGR      1 - 70
LGLGTAGERPRRDNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSVGK                     71 - 124
//

Text Mined References (80)

PMID Year Title