Property Summary

NCBI Gene PubMed Count 258
PubMed Score 2159.14
PubTator Score 1223.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 2.62644706264419E-11

Expression

  Differential Expression (26)

Disease log2 FC p
Breast cancer -1.700 2.6e-11
acute quadriplegic myopathy -1.075 2.8e-03
atypical teratoid / rhabdoid tumor -2.300 1.8e-03
autosomal dominant Emery-Dreifuss muscul... -1.086 2.0e-02
Becker muscular dystrophy -1.041 4.2e-02
chronic rhinosinusitis -1.217 2.4e-02
dermatomyositis -1.200 6.4e-03
Down syndrome 1.600 4.9e-04
Duchenne muscular dystrophy -1.295 5.2e-06
ependymoma 2.800 2.8e-02
gastric carcinoma -1.900 2.5e-03
glioblastoma -2.300 2.4e-02
group 3 medulloblastoma -3.600 4.5e-05
limb girdle muscular dystrophy 2A -1.046 5.3e-04
lung adenocarcinoma -2.100 4.0e-06
lung cancer -5.000 3.2e-06
lung carcinoma -4.300 4.1e-31
medulloblastoma, large-cell -2.400 1.6e-03
non-small cell lung cancer -3.344 6.6e-28
oligodendroglioma 2.700 2.1e-02
pediatric high grade glioma -1.800 7.6e-03
permanent atrial fibrillation -1.200 1.6e-03
pituitary cancer -1.900 2.6e-02
primitive neuroectodermal tumor -2.800 4.5e-02
progressive supranuclear palsy -1.800 2.6e-02
psoriasis -2.800 2.0e-35

 GWAS Trait (1)

Gene RIF (216)

AA Sequence

MSDRPTARRWGKCGPLCTRENIMVAFKGVWTQAFWKAVTAEFLAMLIFVLLSLGSTINWGGTEKPLPVDM      1 - 70
VLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIAAQCLGAIIGAGILYLVTPPS     71 - 140
VVGGLGVTMVHGNLTAGHGLLVELIITFQLVFTIFASCDSKRTDVTGSIALAIGFSVAIGHLFAINYTGA    141 - 210
SMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEV    211 - 280
EDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV                               281 - 323
//

Text Mined References (260)

PMID Year Title