Property Summary

NCBI Gene PubMed Count 234
Grant Count 218
R01 Count 140
Funding $28,547,518.37
PubMed Score 1921.32
PubTator Score 1223.42

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P55087 P78564 AQP-4
Symbols MIWC
WCH4

Gene

PANTHER Protein Class (1)

PDB

3GD8  

Gene RIF (195)

PMID Text
26786101 Based on a comparative mutagenic analysis of AQP1, AQP 3, and AQP 4, the results suggest that loop D interactions may provide a general structural framework for tetrameric assembly within the AQP family.
26638215 Administration of E1 + P1 and E1 + P2 decreased the inhibitory effect of E1 on the IL-6 levels and AQP4 protein expression
26530185 Study shows that the processing of AQP4 by antigen presenting cells in Lewis rats produces a highly encephalitogenic AQP4 epitope (AQP4268-285)
26512424 Measurements of the membrane water permeability of MDCK cells expressing human AQP4 mutants provide the first evidencethat the rate of water flow can also be controlled by small movements of single-amino acid side chains lining the water pore.
26419740 This study demonstrated that Subcellular localization of Aqp4 was compared between cortical and white matter astrocytes in postmortem specimens of patients with focal ischemic stroke versus controls.
26287441 The induction of antibodies to an AQP4 epitope in mice immunized with the TAX1BP1-derived peptide suggests that a latent HTLV-1 infection could lead to TAX1BP1 antigen presentation and the production of anti-AQP4 antibodies in human neuromyelitis optica.
26261083 The study demonstrated the abnormal expression pattern of AQP1, AQP2, AQP3, and AQP4 in the kidney tissues of patients with nephrotic syndrome, providing a basis for an improved understanding of the role of aquaporins in the pathogenesis of this disease.
26115524 the benign subependymomas aquaporins 1 and 4 are dramatically redistributed and upregulated.
26013827 Phosphorylation at serine 276 is necessary for AQP4 translocation in response to changes of tonicity.
26000774 Study identified two AQP4 genomic variants, rs11661256 and rs1058427, as significant predictors of combined intracerebral hemorrhage and perihematomal edema volume after intracerebral hemorrhage
More...

AA Sequence

MSDRPTARRWGKCGPLCTRENIMVAFKGVWTQAFWKAVTAEFLAMLIFVLLSLGSTINWGGTEKPLPVDM      1 - 70
VLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIAAQCLGAIIGAGILYLVTPPS     71 - 140
VVGGLGVTMVHGNLTAGHGLLVELIITFQLVFTIFASCDSKRTDVTGSIALAIGFSVAIGHLFAINYTGA    141 - 210
SMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEV    211 - 280
EDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV                               281 - 323
//

Text Mined References (236)

PMID Year Title
26786101 2016 Structural Determinants of Oligomerization of the Aquaporin-4 Channel.
26638215 2016 Effect of estrogen and/or progesterone administration on traumatic brain injury-caused brain edema: the changes of aquaporin-4 and interleukin-6.
26530185 2015 Highly encephalitogenic aquaporin 4-specific T cells and NMO-IgG jointly orchestrate lesion location and tissue damage in the CNS.
26512424 2015 Control of the Aquaporin-4 Channel Water Permeability by Structural Dynamics of Aromatic/Arginine Selectivity Filter Residues.
26419740 2015 Heterogeneity of aquaporin-4 localization and expression after focal cerebral ischemia underlies differences in white versus grey matter swelling.
26287441 2015 Immunization of mice with a peptide derived from the HTLV-1 TAX1BP1 protein induces cross-reactive antibodies against aquaporin 4.
26261083 2015 Expression pattern of aquaporins in patients with primary nephrotic syndrome with edema.
26115524 2015 Water Channels Aquaporin 4 and -1 Expression in Subependymoma Depends on the Localization of the Tumors.
26013827 2015 Identification and Molecular Mechanisms of the Rapid Tonicity-induced Relocalization of the Aquaporin 4 Channel.
26000774 2015 Aquaporin-4 gene variant independently associated with oedema after intracerebral haemorrhage.
More...