Property Summary

Ligand Count 8
NCBI Gene PubMed Count 321
PubMed Score 253.97
PubTator Score 648.85

Knowledge Summary

Patent (42,924)

Expression

  Differential Expression (26)

Disease log2 FC p
adult high grade glioma 1.600 4.9e-04
astrocytic glioma 1.800 1.7e-02
Astrocytoma, Pilocytic 2.000 2.2e-05
atypical teratoid / rhabdoid tumor 1.400 2.2e-02
Breast cancer -1.600 4.5e-05
colon cancer -1.800 4.9e-02
ependymoma 1.400 5.0e-04
facioscapulohumeral dystrophy 2.800 5.3e-05
glioblastoma 2.000 1.4e-04
hepatocellular carcinoma 1.200 2.0e-04
interstitial cystitis -1.800 2.5e-04
intraductal papillary-mucinous neoplasm ... 1.800 4.9e-02
lung adenocarcinoma 1.867 4.2e-07
malignant mesothelioma -1.200 8.5e-04
medulloblastoma, large-cell 1.300 1.4e-04
nephrosclerosis -1.356 5.5e-03
non-small cell lung cancer 1.117 3.7e-09
osteosarcoma -1.531 1.2e-02
ovarian cancer 2.400 1.2e-03
pancreatic cancer 1.900 2.1e-03
pancreatic carcinoma 1.900 2.1e-03
pituitary cancer -1.500 2.9e-02
Polycystic ovary syndrome -1.327 4.7e-03
primitive neuroectodermal tumor 2.100 4.4e-03
psoriasis 1.300 3.4e-04
ulcerative colitis -1.353 9.8e-03

Protein-protein Interaction (4)

Gene RIF (286)

AA Sequence

MRSPSAAWLLGAAILLAASLSCSGTIQGTNRSSKGRSLIGKVDGTSHVTGKGVTVETVFSVDEFSASVLT      1 - 70
GKLTTVFLPIVYTIVFVVGLPSNGMALWVFLFRTKKKHPAVIYMANLALADLLSVIWFPLKIAYHIHGNN     71 - 140
WIYGEALCNVLIGFFYGNMYCSILFMTCLSVQRYWVIVNPMGHSRKKANIAIGISLAIWLLILLVTIPLY    141 - 210
VVKQTIFIPALNITTCHDVLPEQLLVGDMFNYFLSLAIGVFLFPAFLTASAYVLMIRMLRSSAMDENSEK    211 - 280
KRKRAIKLIVTVLAMYLICFTPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHD    281 - 350
FRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY                           351 - 397
//

Text Mined References (331)

PMID Year Title