Property Summary

NCBI Gene PubMed Count 301
Grant Count 330
R01 Count 216
Funding $34,481,069.72
PubMed Score 238.48
PubTator Score 648.85

Knowledge Summary

Patent (42,924)

Expression

  Differential Expression (26)

Synonym

Accession P55085 Q13317 Q13346 Q53XJ8 PAR-2
Symbols PAR2
GPR11

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (266)

PMID Text
26957205 Data suggest that thrombin can directly activate PAR2 vasorelaxation, signal transduction (stimulating both calcium and MAP kinase responses), and triggering beta-arrestin recruitment (both beta-arrestin 1 and 2).
26839311 Stimulation of PAR-2 activates Nf-kappaB signaling, resulting in RelA nuclear translocation and enhanced expression of pro-inflammatory mRNAs in oral squamous cell carcinoma.
26729042 Activation of PAR-2 by SLIGRL, a PAR-2 specific ligand, leads to dual phosphorylation of both catalytic sites but primarily regulated eNOS-Thr-495 phosphorylation with no change in nitric oxide production.
26666432 involved in pathway induced by house dust mites, which has anti-apoptotic effects on neutrophils of normal and allergic subjects
26658828 PAR-2 expression is increased on CD14++CD16+ monocytes in the peripheral blood of subjects with severe asthma and may be a biomarker of asthma severity.
26600192 Binding of the PH domain of PAR-2 enables breast cancer growth and extravillous trophoblast invasion.
26354435 In colorectal cancer, miR-125b mediates PAR2-induced cancer cell migration by targeting Gab2.
26294672 These findings suggested that the pathophysiology of heartburn sensation or esophageal hypersensitivity may be associated with the activation of PAR-2, TRPV1, and acid-sensing ion channels.
26244666 Results suggest that expression levels of protease activated receptors 1 and 2 (PAR-1 and PAR-2) associate with breast cancer outcome in an estrogen receptor (ER)-dependent manner.
26238490 Data indicate that PAR2 stimulation induces the production of many key inflammatory mediators.
More...

AA Sequence

MRSPSAAWLLGAAILLAASLSCSGTIQGTNRSSKGRSLIGKVDGTSHVTGKGVTVETVFSVDEFSASVLT      1 - 70
GKLTTVFLPIVYTIVFVVGLPSNGMALWVFLFRTKKKHPAVIYMANLALADLLSVIWFPLKIAYHIHGNN     71 - 140
WIYGEALCNVLIGFFYGNMYCSILFMTCLSVQRYWVIVNPMGHSRKKANIAIGISLAIWLLILLVTIPLY    141 - 210
VVKQTIFIPALNITTCHDVLPEQLLVGDMFNYFLSLAIGVFLFPAFLTASAYVLMIRMLRSSAMDENSEK    211 - 280
KRKRAIKLIVTVLAMYLICFTPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHD    281 - 350
FRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY                           351 - 397
//

Text Mined References (311)

PMID Year Title
27006943 2016 Characterization and Functions of Protease-Activated Receptor 2 in Obesity, Diabetes, and Metabolic Syndrome: A Systematic Review.
26957205 2016 Thrombin-Mediated Direct Activation of Proteinase-Activated Receptor-2: Another Target for Thrombin Signaling.
26839311 2016 Protease-activated Receptor-2 (PAR-2)-mediated Nf-?B Activation Suppresses Inflammation-associated Tumor Suppressor MicroRNAs in Oral Squamous Cell Carcinoma.
26729042 2016 Featured Article: Differential regulation of endothelial nitric oxide synthase phosphorylation by protease-activated receptors in adult human endothelial cells.
26666432 2016 House dust mite allergen suppresses neutrophil apoptosis by cytokine release via PAR2 in normal and allergic lymphocytes.
26658828 2015 Increased Protease-Activated Receptor-2 (PAR-2) Expression on CD14++CD16+ Peripheral Blood Monocytes of Patients with Severe Asthma.
26600192 2015 PH motifs in PAR1&2 endow breast cancer growth.
26354435 2015 Proteinase-activated receptor 2 promotes cancer cell migration through RNA methylation-mediated repression of miR-125b.
26294672 2015 PAR-2 activation enhances weak acid-induced ATP release through TRPV1 and ASIC sensitization in human esophageal epithelial cells.
26244666 2015 Protease Activated Receptors 1 and 2 Correlate Differently with Breast Cancer Aggressiveness Depending on Tumor ER Status.
More...