Property Summary

NCBI Gene PubMed Count 38
PubMed Score 118.42
PubTator Score 80.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (6)

Disease log2 FC p
group 4 medulloblastoma -1.300 1.3e-04
medulloblastoma, large-cell -1.400 1.7e-05
Multiple myeloma 1.202 3.7e-03
ovarian cancer -1.600 2.5e-05
pancreatic ductal adenocarcinoma liver m... -1.259 3.1e-02
Waldenstrons macroglobulinemia 1.313 4.8e-03

Protein-protein Interaction (4)

Gene RIF (15)

AA Sequence

MTILTYPFKNLPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTS      1 - 70
YKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACIS     71 - 140
ANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPE    141 - 210
LPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNG    211 - 280
IRPSSLEQMAKLKPAFIKPYGTVTAANSSFLTDGASAMLIMAEEKALAMGYKPKAYLRDFMYVSQDPKDQ    281 - 350
LLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAENYMGRKTKVGLPPLEKFNNW    351 - 420
GGSLSLGHPFGATGCRLVMAAANRLRKEGGQYGLVAACAAGGQGHAMIVEAYPK                    421 - 474
//

Text Mined References (43)

PMID Year Title