Property Summary

NCBI Gene PubMed Count 20
PubMed Score 246.54
PubTator Score 18.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 2.26258457189312E-24
non-small cell lung cancer 2798 7.42286599659199E-22
posterior fossa group A ependymoma 1511 1.80761622344881E-13
lung adenocarcinoma 2714 4.46943976341714E-12
lung cancer 4473 9.84266844292948E-8
pituitary cancer 1972 4.0651921562383E-7
malignant mesothelioma 3163 1.57102927775733E-5
sonic hedgehog group medulloblastoma 1482 6.69854834382411E-5
breast carcinoma 1614 1.53720970569643E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 4.40060688966775E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.88852581298787E-4
Atopic dermatitis 944 7.4438640310173E-4
invasive ductal carcinoma 2950 7.50941050102537E-4
adrenocortical carcinoma 1427 0.00109116064197039
adult high grade glioma 2148 0.0016798374458098
diabetes mellitus 1663 0.00189918662420635
psoriasis 6685 0.00192423268099687
pancreatic cancer 2300 0.00349026227106979
medulloblastoma, large-cell 6234 0.00547015634331745
colon cancer 1475 0.00679470839326724
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00812089916627897
primary pancreatic ductal adenocarcinoma 1271 0.0104435099623657
mucosa-associated lymphoid tissue lymphoma 480 0.0127286683341244
cutaneous lupus erythematosus 1056 0.0190322528105549
ductal carcinoma in situ 1745 0.019170956163481

Expression

Synonym

Accession P55083 A8KAJ1 A8MVM2 B4E317 Q6P680
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (7)

Gene RIF (9)

PMID Text
26601954 Data suggest that MFAP4 specifically binds tropoelastin and fibrillin-1/-2, as well as elastin cross-linking amino acid desmosine; MFAP4 co-localizes with fibrillin-1-positive fibers; MFAP4 actively promotes tropoelastin self-assembly.
26564819 MFAP4 regulates integrin alphaVbeta3-induced VSMC proliferation and migration, as well as monocyte chemotaxis, and accelerates neointimal hyperplasia after vascular injury.
26460565 plasma MFAP4 was significantly increased among patients with a previous diagnosis of liver disease or congestive heart failure compared to patients with other diagnoses.
24349233 Serum MFAP4 varies in groups of patients with different cardiovascular conditions.
24324779 The findings support the biomarker potential of systemic MFAP4, with elevated levels in the serum reflecting pathological processes involving ECM remodeling and degradation.
22355679 skin with enhanced MFAP-4 expression was protected from UVB-induced photodamage/photoaging accompanied by the prevention of ECM degradation and aggravated elasticity
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
17539903 Observational study of gene-disease association. (HuGE Navigator)
16867155 Microfibrillar associated protein 4 binds pulmonary surfactant protein A (SP-A) and colocalizes with SP-A in the extracellular matrix of the lung.

AA Sequence

MKALLALPLLLLLSTPPCAPQVSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFC      1 - 70
DMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTA     71 - 140
YAKYADFSISPNAVSAEEDGYTLFVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFR    141 - 210
SCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA                             211 - 255
//

Text Mined References (23)

PMID Year Title
26601954 2016 Characterization of Microfibrillar-associated Protein 4 (MFAP4) as a Tropoelastin- and Fibrillin-binding Protein Involved in Elastic Fiber Formation.
26564819 2016 MFAP4 Promotes Vascular Smooth Muscle Migration, Proliferation and Accelerates Neointima Formation.
26460565 2015 Microfibrillar-Associated Protein 4: A Potential Biomarker for Screening for Liver Fibrosis in a Mixed Patient Cohort.
24349233 2013 Localization of microfibrillar-associated protein 4 (MFAP4) in human tissues: clinical evaluation of serum MFAP4 and its association with various cardiovascular conditions.
24324779 2013 Enzyme-linked immunosorbent assay characterization of basal variation and heritability of systemic microfibrillar-associated protein 4.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22355679 2011 Essential role of microfibrillar-associated protein 4 in human cutaneous homeostasis and in its photoprotection.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
More...