Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.82
PubTator Score 1.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Schizophrenia 1160 0.0 1.0

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 2.1e-03
ependymoma 1.100 6.5e-05
group 3 medulloblastoma -1.100 4.5e-03
medulloblastoma, large-cell 1.700 2.2e-05
osteosarcoma 1.721 4.2e-03

Gene RIF (2)

AA Sequence

MKLHCCLFTLVASIIVPAAFVLEDVDFDQMVSLEANRSSYNASFPSSFELSASSHSDDDVIIAKEGTSVS      1 - 70
IECLLTASHYEDVHWHNSKGQQLDGRSRGGKWLVSDNFLNITNVAFDDRGLYTCFVTSPIRASYSVTLRV     71 - 140
IFTSGDMSVYYMIVCLIAFTITLILNVTRLCMMSSHLRKTEKAINEFFRTEGAEKLQKAFEIAKRIPIIT    141 - 210
SAKTLELAKVTQFKTMEFARYIEELARSVPLPPLILNCRAFVEEMFEAVRVDDPDDLGERIKERPALNAQ    211 - 280
GGIYVINPEMGRSNSPGGDSDDGSLNEQGQEIAVQVSVHLQSETKSIDTESQGSSHFSPPDDIGSAESNC    281 - 350
NYKDGAYENCQL                                                              351 - 362
//

Text Mined References (9)

PMID Year Title