Property Summary

NCBI Gene PubMed Count 64
Grant Count 345
R01 Count 217
Funding $34,495,586.87
PubMed Score 513.17
PubTator Score 221.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 1.300 0.012

Synonym

Accession P55075 A1A514 Q14915 Q15766 FGF-8
Symbols HH6
AIGF
KAL6
FGF-8
HBGF-8

Gene

PANTHER Protein Class (2)

PDB

2FDB  

Gene RIF (34)

PMID Text
25911675 Our results link FGF8, c-Abl and p300 in a regulatory pathway that controls DeltaNp63alpha protein stability and transcriptional activity.
25473897 Data indicate that overexpression of fibroblast growth factor 8 (FGF8) correlates with lymph node metastasis and poor prognosis in colorectal cancer (CRC).
25131394 FGF8 mutations (p.Gly29_Arg34dup and p.Pro26Leu) contribute to the formation of the VATER/VACTERL association.
24849601 Scube3 may be a critical upstream regulator of fast fiber myogenesis by modulating fgf8 signaling during zebrafish embryogenesis
24464787 The oncoprotein HBXIP enhances angiogenesis and growth of breast cancer through modulating FGF8 and VEGF.
23994638 Regulation of neurogenesis by Fgf8a requires Cdc42 signaling and a novel Cdc42 effector protein
23906837 Together, these data demonstrate that FGF (FGFR-2 and Fgf8)signaling regulates cell proliferation and cell polarity and that these cell processes contribute to facial morphogenesis.
23533228 genetic association study in population in Massachusetts: Data suggest that clinical features in Kallmann syndrome (KS) are associated with genetic causes: dental agenesis/digital bony abnormalities are associated with variations/mutations in FGF8.
23466786 A novel FGF8b-binding peptide with anti-tumor effect on prostate cancer.
22423049 The results suggest that prolonged and enhanced human fibroblast growth factor 8b signaling induces dramatic changes in the epididymis and testis that lead to infertility in a portion of the human fibroblast growth factor 8b transgenic male mice.
More...

AA Sequence

MGSPRSALSCLLLHLLVLCLQAQEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLVTDQLSRRLIR      1 - 70
TYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNG     71 - 140
KGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFE    141 - 210
FLNYPPFTRSLRGSQRTWAPEPR                                                   211 - 233
//

Text Mined References (66)

PMID Year Title
25911675 2015 FGF8, c-Abl and p300 participate in a pathway that controls stability and function of the ?Np63? protein.
25473897 2015 FGF8 promotes colorectal cancer growth and metastasis by activating YAP1.
25131394 2014 Heterozygous FGF8 mutations in patients presenting cryptorchidism and multiple VATER/VACTERL features without limb anomalies.
24849601 2014 SCUBE3 (signal peptide-CUB-EGF domain-containing protein 3) modulates fibroblast growth factor signaling during fast muscle development.
24464787 2014 The oncoprotein HBXIP enhances angiogenesis and growth of breast cancer through modulating FGF8 and VEGF.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
23994638 2013 Regulation of neurogenesis by Fgf8a requires Cdc42 signaling and a novel Cdc42 effector protein.
23906837 2013 Quantification of shape and cell polarity reveals a novel mechanism underlying malformations resulting from related FGF mutations during facial morphogenesis.
23643382 2013 Mutations in FGF17, IL17RD, DUSP6, SPRY4, and FLRT3 are identified in individuals with congenital hypogonadotropic hypogonadism.
23533228 2013 Prioritizing genetic testing in patients with Kallmann syndrome using clinical phenotypes.
More...