Property Summary

NCBI Gene PubMed Count 67
PubMed Score 532.00
PubTator Score 221.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count P-value
group 3 medulloblastoma 4104 1.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Holoprosencephaly 56 4.606 2.3
Disease Target Count Z-score Confidence
Klinefelter's syndrome 56 0.0 4.0

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 1.300 1.2e-02

Gene RIF (37)

AA Sequence

MGSPRSALSCLLLHLLVLCLQAQEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLVTDQLSRRLIR      1 - 70
TYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNG     71 - 140
KGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFE    141 - 210
FLNYPPFTRSLRGSQRTWAPEPR                                                   211 - 233
//

Text Mined References (69)

PMID Year Title