Property Summary

NCBI Gene PubMed Count 39
PubMed Score 91.16
PubTator Score 180.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
posterior fossa group A ependymoma 1.200 0.002
lung adenocarcinoma -1.100 0.000
psoriasis -1.700 0.000

Synonym

Accession P55073 G3XAM0 Q8WVN5
Symbols D3
5DIII
TXDI3
DIOIII

Gene

Gene RIF (32)

PMID Text
26825960 MAPK and SHH pathways modulate type 3 deiodinase expression in papillary thyroid carcinoma
26727108 D3 is a critical factor in testis development and in testicular protection from thyrotoxicosis.
25304215 Thyroid hormone deiodinases D1, D2, and D3 are differentially expressed in endothelial cells following thyroid hormone exposure.
24878678 [review] D3 polymorphisms show no relationship with inter-individual variation in serum thyroid hormone parameters.
24816254 the imprinted DLK1-DIO3 locus is regulated by noncoding RNA IPW in an induced pluripotent stem cell model of Prader-Willi syndrome
24317514 the microRNA cluster at the Dlk1-Dio3 locus is upregulated in lung adenocarcinoma
24123616 Overall, the data suggest that active expression of the DLK1-DIO3 cluster represents a new biomarker for epigenetic stability of hESCs and indicates the importance of using a proper physiological oxygen level during the derivation and culture of hESCs.
23857380 Data indicate that Na+/I- symporter and type 3 iodothyronine deiodinase genes are expressed in term placenta and amniotic membrane.
23271316 Treatment with high affinity amyloidbeta42 oligomer-binding enantiomeric D3 peptide significantly decreases amyloidbeta deposits and the associated inflammatory response and improves cognition, even when applied only at late stages and high age.
23235188 D3 expression is re-activated in various types of human cancers. It may play a role in carcinogenesis and neoplastic cell proliferation. Review.
More...

AA Sequence

MPRQATSRLVVGEGEGSQGASGPAATMLRSLLLHSLRLCAQTASCLVLFPRFLGTAFMLWLLDFLCIRKH      1 - 70
FLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEV     71 - 140
VLPDGFQSQHILDYAQGNRPLVLNFGSCTUPPFMARMSAFQRLVTKYQRDVDFLIIYIEEAHPSDGWVTT    141 - 210
DSPYIIPQHRSLEDRVSAARVLQQGAPGCALVLDTMANSSSSAYGAYFERLYVIQSGTIMYQGGRGPDGY    211 - 280
QVSELRTWLERYDEQLHGARPRRV                                                  281 - 304
//

Text Mined References (40)

PMID Year Title
26825960 2016 MAPK and SHH pathways modulate type 3 deiodinase expression in papillary thyroid carcinoma.
26727108 2016 The Type 3 Deiodinase Is a Critical Determinant of Appropriate Thyroid Hormone Action in the Developing Testis.
25304215 2015 Thyroid hormone deiodinases D1, D2, and D3 are expressed in human endothelial dermal microvascular line: effects of thyroid hormones.
24878678 2014 Genetics in endocrinology: genetic variation in deiodinases: a systematic review of potential clinical effects in humans.
24816254 2014 The noncoding RNA IPW regulates the imprinted DLK1-DIO3 locus in an induced pluripotent stem cell model of Prader-Willi syndrome.
24317514 2015 Upregulation of the microRNA cluster at the Dlk1-Dio3 locus in lung adenocarcinoma.
24123616 2014 Physiological oxygen prevents frequent silencing of the DLK1-DIO3 cluster during human embryonic stem cells culture.
23857380 2013 Na+/I- symporter and type 3 iodothyronine deiodinase gene expression in amniotic membrane and placenta and its relationship to maternal thyroid hormones.
23271316 2013 Treatment with D3 removes amyloid deposits, reduces inflammation, and improves cognition in aged A?PP/PS1 double transgenic mice.
23235188 2012 Deiodination in cancer growth: the role of type III deiodinase.
More...