Property Summary

NCBI Gene PubMed Count 284
Grant Count 167
R01 Count 81
Funding $23,768,060.39
PubMed Score 686.57
PubTator Score 506.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.060 0.004
Multiple myeloma 1.169 0.001
psoriasis 2.000 0.000
osteosarcoma 1.107 0.000
astrocytoma 1.500 0.002
pancreatic ductal adenocarcinoma liver m... -1.451 0.009
Pick disease 1.400 0.000
ovarian cancer 1.900 0.000

Synonym

Accession P55072 B2R5T8 Q0V924 Q2TAI5 Q969G7 Q9UCD5 TER ATPase
Symbols p97
TERA
ALS14
CMT2Y
IBMPFD
HEL-220
IBMPFD1
HEL-S-70

Gene

VCP

PDB

3TIW   3QC8   3QQ8   3QWZ   4P0A   5C1B   5EPP   3EBB   3HU1   3HU2   3HU3   3QQ7   4KDI   4KDL   4KLN   4KO8   4KOD   5C18   5C19   5C1A   5DYG   5DYI   5FTJ   5FTK   5FTL   5FTM   5FTN  

MLP Assay (15)

AID Type Active / Inconclusive / Inactive Description
1481 screening 925 / 0 / 217192 Primary biochemical high-throughput screening assay to measure P97 ATPase inhibition
1517 screening 333 / 0 / 426 Confirmation biochemical high-throughput screening assay for inhibitors of the p97 ATPase
1534 confirmatory 5 / 0 / 49 Dose response biochemical high throughput screening assay for inhibitors of the p97 ATPase
1544 confirmatory 1 / 0 / 53 Luminescence counterscreen assay for p97 inhibitors: Dose response biochemical high throughput screening assay to identify inhibitors of the C522A mutant p97 ATPase.
1551 confirmatory 1 / 0 / 15 Luminescence dose response biochemical high throughput screening assay for inhibitors of the p97 ATPase: synthesized compounds.
1629 confirmatory 0 / 0 / 16 Luminescence counterscreen assay for p97 inhibitors: dose response biochemical high throughput screening assay to identify inhibitors of the C522A mutant p97 ATPase: synthesized compounds.
1794 summary 1 / 0 / 0 Summary of probe development efforts to identify inhibitors of the p97 ATPase.
2131 screening 3 / 0 / 9 Late stage results from the probe development effort to identify inhibitors of the p97 ATPase.
463184 confirmatory 20 / 0 / 9 p97 ATPase dose response
463185 confirmatory 32 / 0 / 24 Inhibition of proteasomal turnover of a p97-dependent reporter substrate in human cells
More...

Gene RIF (212)

PMID Text
27226613 results have revealed SUMOylation as a molecular signaling switch to regulate the distribution and functions of VCP during stress response, and suggest that deficiency in VCP SUMOylation caused by pathogenic mutations will render cells vulnerable to stress insults.
26826127 new role of VCP/p97 segregase in the timely processing of ubiquitinated CSB from damaged chromatin.
26797118 Ankrd13 proteins cooperate with VCP to regulate the lysosomal trafficking of ubiquitinated Cav-1.
26720340 depletion of VCP enzymatic activity triggers cancer cell death in part through inadequate regulation of protein synthesis and amino acid metabolism.
26555175 Data indicate that ATPase p97 is a key mediator of several protein homeostasis processes and is a strong potential cancer target.
26549226 Our results provide the first structural clues of how VCP mutations may influence the activity and function of the D2 ATPase ring.
26504085 interaction between SelK and p97(VCP) is SelS-dependent, and the resulting ERAD complex (SelS-p97(VCP)-SelK) plays an important role in ERAD and ER stress
26475856 UBXD1-N intercalates into the p97-ND1 interface, thereby modulating interdomain communication of p97 domains and its activity with relevance for disease pathogenesis
26463207 activity of the p97-associated deubiquitinylase YOD1 is also required for substrate disposal
26389662 Data show that UBXN10 localizes to cilia in a AAA-ATPase VCP-dependent manner and both VCP and UBXN10 are required for ciliogenesis.
More...

AA Sequence

MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCI      1 - 70
VLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFL     71 - 140
EAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCR    141 - 210
KQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAG    211 - 280
ESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRP    281 - 350
NSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAAL    351 - 420
QAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQ    421 - 490
ELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVR    491 - 560
EIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIID    561 - 630
PAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIR    631 - 700
ESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGS    701 - 770
FRFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLYG                                      771 - 806
//

Text Mined References (309)

PMID Year Title
27226613 2016 Pathogenic Mutations in the Valosin-containing Protein/p97(VCP) N-domain Inhibit the SUMOylation of VCP and Lead to Impaired Stress Response.
27209344 2016 Nuclear inclusions mimicking poly(A)-binding protein nuclear 1 inclusions in a case of inclusion body myopathy associated with Paget disease of bone and frontotemporal dementia with a novel mutation in the valosin-containing protein gene.
26849035 2016 Nucleotide-dependent conformational changes of the AAA+ ATPase p97 revisited.
26826127 2016 Valosin-containing Protein (VCP)/p97 Segregase Mediates Proteolytic Processing of Cockayne Syndrome Group B (CSB) in Damaged Chromatin.
26797118 2016 The Ankrd13 Family of Ubiquitin-interacting Motif-bearing Proteins Regulates Valosin-containing Protein/p97 Protein-mediated Lysosomal Trafficking of Caveolin 1.
26720340 2015 Inadequate fine-tuning of protein synthesis and failure of amino acid homeostasis following inhibition of the ATPase VCP/p97.
26555175 2015 Targeting the AAA ATPase p97 as an Approach to Treat Cancer through Disruption of Protein Homeostasis.
26549226 2015 Cryo-EM of the pathogenic VCP variant R155P reveals long-range conformational changes in the D2 ATPase ring.
26504085 2015 Selenoprotein S-dependent Selenoprotein K Binding to p97(VCP) Protein Is Essential for Endoplasmic Reticulum-associated Degradation.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
More...