Property Summary

NCBI Gene PubMed Count 45
PubMed Score 305.33
PubTator Score 113.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytoma 1.100 5.0e-02
Astrocytoma, Pilocytic 1.100 1.7e-05
atypical teratoid / rhabdoid tumor 1.500 1.7e-06
Breast cancer 1.300 4.5e-14
cutaneous lupus erythematosus 1.500 7.9e-04
Down syndrome 1.300 6.3e-04
ependymoma 1.300 7.8e-09
glioblastoma 1.200 6.5e-05
lung cancer -1.400 3.9e-03
Multiple myeloma 1.223 5.3e-03
oligodendroglioma 1.400 2.7e-02
ovarian cancer -1.100 2.0e-03
pancreatic ductal adenocarcinoma liver m... -1.407 5.5e-04
pediatric high grade glioma 1.700 4.2e-07
tuberculosis and treatment for 6 months -1.200 6.8e-04
ulcerative colitis -1.010 4.4e-02

Gene RIF (33)

AA Sequence

MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIW      1 - 70
LMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSY     71 - 140
LFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDL    141 - 210
FLDFITVFRKLMMILAMNEKDKKKEKK                                               211 - 237
//

Text Mined References (47)

PMID Year Title