Property Summary

NCBI Gene PubMed Count 44
Grant Count 21
R01 Count 12
Funding $2,579,770.28
PubMed Score 291.04
PubTator Score 113.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.223 0.005
oligodendroglioma 1.400 0.027
cutaneous lupus erythematosus 1.500 0.001
ependymoma 1.300 0.000
glioblastoma 2.000 0.003
astrocytoma 1.300 0.004
atypical teratoid / rhabdoid tumor 1.500 0.000
ulcerative colitis -1.010 0.044
tuberculosis and treatment for 6 months -1.200 0.001
pancreatic ductal adenocarcinoma liver m... -1.407 0.001
lung cancer -1.700 0.000
pediatric high grade glioma 1.700 0.000
pilocytic astrocytoma 1.100 0.000
Breast cancer 1.300 0.000
ovarian cancer 1.400 0.001
Down syndrome 1.300 0.001

Gene RIF (33)

PMID Text
25973025 BI-1 is overexpressed and promotes the progression and metastasis of non-small cell lung cancer
25764978 These results suggest that the TMBIM family has comparable functions in the maintenance of intracellular Ca(2) homeostasis in a wide variety of tissues
25227609 Bax inhibitor-1 is likely a pH-sensitive calcium leak channel, not a H+/Ca2+ exchanger.
24625972 Results highlight the regulatory role of BI-1 in idiopathic pulmonary fibrosis.
24344041 Constructed lentivirus expression vector for transfecting BI-1.
24314142 BI-1 enhances glucose metabolism, leading to high activation of the sodium/hydrogen exchange for intracellular pH homeostasis.
23867001 The effect of Bax Inhibitor-1(TMBIM6) as a regulatorof endoplasmic reticulum Ca2+ homeostasis is regulated by intracellular pH by removing negative charges.
22588718 The results reveal BI-1 as a novel autophagy regulator that bridges Ca(2) signaling between ER and mitochondria, reducing cellular oxygen consumption and contributing to cellular resilience in the face of metabolic stress.
22418439 Data indicate that GAAP and BI-1 have a six membrane-spanning topology with cytosolic N and C termini and a C-terminal reentrant loop.
22128171 The C terminus of Bax inhibitor-1 forms a Ca2+-permeable channel pore.
More...

AA Sequence

MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIW      1 - 70
LMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSY     71 - 140
LFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDL    141 - 210
FLDFITVFRKLMMILAMNEKDKKKEKK                                               211 - 237
//

Text Mined References (46)

PMID Year Title
25973025 2015 Bax inhibitor-1 is overexpressed in non-small cell lung cancer and promotes its progression and metastasis.
25764978 2015 The transmembrane Bax inhibitor motif (TMBIM) containing protein family: Tissue expression, intracellular localization and effects on the ER CA²?-filling state.
25227609 2014 Bax inhibitor-1 is likely a pH-sensitive calcium leak channel, not a H+/Ca2+ exchanger.
24625972 2014 BAX inhibitor-1-associated V-ATPase glycosylation enhances collagen degradation in pulmonary fibrosis.
24344041 Construction and identification of the recombinant lentiviral expression vector targeting human BAX inhibitor-1 gene.
24314142 2014 BI-1 enhances Fas-induced cell death through a Na+/H+-associated mechanism.
23867001 2013 Bax Inhibitor-1-mediated Ca2+ leak is decreased by cytosolic acidosis.
22588718 2012 Endoplasmic reticulum protein BI-1 regulates Ca²?-mediated bioenergetics to promote autophagy.
22418439 2012 Six-transmembrane topology for Golgi anti-apoptotic protein (GAAP) and Bax inhibitor 1 (BI-1) provides model for the transmembrane Bax inhibitor-containing motif (TMBIM) family.
22128171 2012 The C terminus of Bax inhibitor-1 forms a Ca2+-permeable channel pore.
More...