Property Summary

NCBI Gene PubMed Count 48
Grant Count 178
R01 Count 96
Funding $63,676,925.26
PubMed Score 97.58
PubTator Score 130.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.001
Waldenstrons macroglobulinemia 1.239 0.012
Multiple myeloma 1.328 0.003
juvenile dermatomyositis 1.102 0.000
acute quadriplegic myopathy 1.197 0.000
tuberculosis and treatment for 3 months -1.300 0.000
non-small cell lung cancer 1.256 0.000
colon cancer 2.000 0.020
lung cancer 2.400 0.000
Breast cancer 2.700 0.038
nasopharyngeal carcinoma 1.700 0.000
ovarian cancer 3.200 0.000
dermatomyositis 2.100 0.000

Synonym

Gene

PANTHER Protein Class (3)

Gene RIF (29)

PMID Text
26668314 CAS plays contrasting roles in proliferation and apoptosis
26278417 There is a relationship between nuclear CSE1L overexpression and distant metastasis in breast cancer.
26123175 hCAS/CSE1L is responsible for controlling the homologous recombinational repair activity by directly interacting with RAD51.
25973023 nuclear CSE1L is mainly non-phosphorylated CSE1L and is involved in gene regulation and cytoplasmic CSE1L is mainly phosphorylated CSE1L and is involved in cytoplasmic signaling regulation in melanocytic tumorigenesis.
24799195 The cellular apoptosis susceptibility/importin-alpha1 transport cycle is linked to X-linked inhibitor (XIAP) and is required to maintain tumor cell survival in hepatocellular carcinoma.
23806821 Most colorectal tumors were positive for CSE1L staining (98.4%). CRT's with K-Ras mutation or high cytoplasmic CSE1L expression were correlated with T status (depth of tumor penetration; P = .004), stage (P = .004), and lymph node metastasis (P = .019).
23621178 CSE1L expression was significantly inhibited in RKO cells, causing cell cycle arrest in the G2/M and S phases and a delay in cell proliferation, as well as induction of apoptosis and an inhibition of colony growth capacity.
23189846 CAS protein expression is related closely to tumor differentiation in hepatocellular carcinoma tissues.
22967991 CSE1L- and inhibitor of DNA binding-3 (ID3)-overexpression was associated with the diagnosis of BL and signal transduction and transcription-3 (STAT3) with DLBCL (P<0.001 for all markers). All three markers were associated with patient outcome in DLBCL
22952058 CSE1L may be involved in the "early" and "late" metastasis of tumor cells in tumorigenesis.
More...

AA Sequence

MELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQNYPLLLLTLLEKSQDNVIKVCASVTFKNYI      1 - 70
KRNWRIVEDEPNKICEADRVAIKANIVHLMLSSPEQIQKQLSDAISIIGREDFPQKWPDLLTEMVNRFQS     71 - 140
GDFHVINGVLRTAHSLFKRYRHEFKSNELWTEIKLVLDAFALPLTNLFKATIELCSTHANDASALRILFS    141 - 210
SLILISKLFYSLNFQDLPEFFEDNMETWMNNFHTLLTLDNKLLQTDDEEEAGLLELLKSQICDNAALYAQ    211 - 280
KYDEEFQRYLPRFVTAIWNLLVTTGQEVKYDLLVSNAIQFLASVCERPHYKNLFEDQNTLTSICEKVIVP    281 - 350
NMEFRAADEEAFEDNSEEYIRRDLEGSDIDTRRRAACDLVRGLCKFFEGPVTGIFSGYVNSMLQEYAKNP    351 - 420
SVNWKHKDAAIYLVTSLASKAQTQKHGITQANELVNLTEFFVNHILPDLKSANVNEFPVLKADGIKYIMI    421 - 490
FRNQVPKEHLLVSIPLLINHLQAESIVVHTYAAHALERLFTMRGPNNATLFTAAEIAPFVEILLTNLFKA    491 - 560
LTLPGSSENEYIMKAIMRSFSLLQEAIIPYIPTLITQLTQKLLAVSKNPSKPHFNHYMFEAICLSIRITC    561 - 630
KANPAAVVNFEEALFLVFTEILQNDVQEFIPYVFQVMSLLLETHKNDIPSSYMALFPHLLQPVLWERTGN    631 - 700
IPALVRLLQAFLERGSNTIASAAADKIPGLLGVFQKLIASKANDHQGFYLLNSIIEHMPPESVDQYRKQI    701 - 770
FILLFQRLQNSKTTKFIKSFLVFINLYCIKYGALALQEIFDGIQPKMFGMVLEKIIIPEIQKVSGNVEKK    771 - 840
ICAVGITKLLTECPPMMDTEYTKLWTPLLQSLIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAG    841 - 910
KKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAASVTLL             911 - 971
//

Text Mined References (58)

PMID Year Title
26668314 2016 The Cellular Apoptosis Susceptibility Protein (CAS) Promotes Tumor Necrosis Factor-related Apoptosis-inducing Ligand (TRAIL)-induced Apoptosis and Cell Proliferation.
26278417 2015 Does CSE1L Overexpression Affect Distant Metastasis Development in Breast Cancer?
26123175 2015 hCAS/CSE1L regulates RAD51 distribution and focus formation for homologous recombinational repair.
25973023 2015 High expression of cytoplasmic phosphorylated CSE1L in malignant melanoma but not in benign nevi: phosphorylated CSE1L for the discrimination between melanoma and benign nevi.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24799195 2014 Prosurvival function of the cellular apoptosis susceptibility/importin-?1 transport cycle is repressed by p53 in liver cancer.
24489884 2014 Genome-wide association study of proneness to anger.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23806821 2013 CSE1L modulates Ras-induced cancer cell invasion: correlation of K-Ras mutation and CSE1L expression in colorectal cancer progression.
23621178 2013 Suppression of cellular apoptosis susceptibility (CSE1L) inhibits proliferation and induces apoptosis in colorectal cancer cells.
More...