Property Summary

NCBI Gene PubMed Count 52
PubMed Score 99.19
PubTator Score 130.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute quadriplegic myopathy 1.197 5.6e-06
Breast cancer 2.700 3.8e-02
colon cancer 2.000 2.0e-02
dermatomyositis 2.100 5.0e-04
hepatocellular carcinoma 1.100 9.1e-04
juvenile dermatomyositis 1.102 2.8e-09
lung cancer 2.000 8.1e-05
Multiple myeloma 1.328 2.7e-03
nasopharyngeal carcinoma 1.700 3.0e-08
non-small cell lung cancer 1.256 8.1e-15
ovarian cancer 3.200 1.6e-07
tuberculosis and treatment for 3 months -1.300 4.4e-04
Waldenstrons macroglobulinemia 1.239 1.2e-02

Gene RIF (32)

AA Sequence

MELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQNYPLLLLTLLEKSQDNVIKVCASVTFKNYI      1 - 70
KRNWRIVEDEPNKICEADRVAIKANIVHLMLSSPEQIQKQLSDAISIIGREDFPQKWPDLLTEMVNRFQS     71 - 140
GDFHVINGVLRTAHSLFKRYRHEFKSNELWTEIKLVLDAFALPLTNLFKATIELCSTHANDASALRILFS    141 - 210
SLILISKLFYSLNFQDLPEFFEDNMETWMNNFHTLLTLDNKLLQTDDEEEAGLLELLKSQICDNAALYAQ    211 - 280
KYDEEFQRYLPRFVTAIWNLLVTTGQEVKYDLLVSNAIQFLASVCERPHYKNLFEDQNTLTSICEKVIVP    281 - 350
NMEFRAADEEAFEDNSEEYIRRDLEGSDIDTRRRAACDLVRGLCKFFEGPVTGIFSGYVNSMLQEYAKNP    351 - 420
SVNWKHKDAAIYLVTSLASKAQTQKHGITQANELVNLTEFFVNHILPDLKSANVNEFPVLKADGIKYIMI    421 - 490
FRNQVPKEHLLVSIPLLINHLQAESIVVHTYAAHALERLFTMRGPNNATLFTAAEIAPFVEILLTNLFKA    491 - 560
LTLPGSSENEYIMKAIMRSFSLLQEAIIPYIPTLITQLTQKLLAVSKNPSKPHFNHYMFEAICLSIRITC    561 - 630
KANPAAVVNFEEALFLVFTEILQNDVQEFIPYVFQVMSLLLETHKNDIPSSYMALFPHLLQPVLWERTGN    631 - 700
IPALVRLLQAFLERGSNTIASAAADKIPGLLGVFQKLIASKANDHQGFYLLNSIIEHMPPESVDQYRKQI    701 - 770
FILLFQRLQNSKTTKFIKSFLVFINLYCIKYGALALQEIFDGIQPKMFGMVLEKIIIPEIQKVSGNVEKK    771 - 840
ICAVGITKLLTECPPMMDTEYTKLWTPLLQSLIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAG    841 - 910
KKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAASVTLL             911 - 971
//

Text Mined References (63)

PMID Year Title